DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and Bahcc1

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:XP_008774088.1 Gene:Bahcc1 RGDID:1306500 Length:2628 Species:Rattus norvegicus

Alignment Length:2977 Identity:568/2978 (19%)
Similarity:921/2978 (31%) Gaps:853/2978 (29%)


  Fly    15 RSTATAAAAAAAAAAAATASSTQ-GKKRPGKQTKASGGGGDEADDKKSASKTDSAAKKPAKDPTG 78
            ||.|.||..|.|..||..|:..| ||..|.....||                .:|:.:...:|..
  Rat     1 RSAAAAARLAPAGPAAQPAAHFQPGKYFPSPLPMAS----------------HTASSRLMGNPPA 49

  Fly    79 SSGVSTATTEGGAGNGGGKQTTSTTTSSTSSTTAPSASASASASNSLKLSPEERHEDGKARAINK 143
            ||.:.:..|     :..|...::.....|||.:.|:...|..|::.:..|  ..||.......:.
  Rat    50 SSFMGSFLT-----SSLGSAASAHPNGPTSSPSEPAYRGSHPATSQIWFS--HSHEAPAYPRFSG 107

  Fly   144 MLKSLDIKI-----HGFDNLLPSGEERLNDGVLKSSI--------------SENVKTKSRAAAVK 189
            .|.|..:.:     ||..|:| .|:.|.. |..|.:.              :.|.....||....
  Rat   108 SLASTFLPVSHLDHHGNSNVL-YGQHRFY-GTQKDNFYLRNLPPQPAILPANHNFHGVPRATPTH 170

  Fly   190 VISSLNPGKMPPVKRVRPSPEPVR------------EKVAEKPAEKVLDKEKPKAEQQITPP--- 239
            .|.|.:..::......:...|..|            .||||.....|:::|..|..|::.||   
  Rat   171 PIGSCSRDRIEAASLQKGPKEFDRFLMGKELGKEKASKVAEGRERPVVEEESSKDRQKLVPPMPA 235

  Fly   240 --PAPEESPASKVPKKTVQQAKKAKVESSLVQATVLTTTSAATSAPSSAS---TSKHTSTKNPGK 299
              |..|..||   |:.:.:...| .:.|.|:...||.......|..|.|.   ....|....||:
  Rat   236 EGPCKETGPA---PRGSCEGRPK-HLTSCLLNTKVLNGDMGKASMASCAGGMLGRPGTGVAAPGR 296

  Fly   300 KSAHSEQMPKKELSKLAKMGKPKKEANLVKSTARLPDSNTESVQMELEEIVSTPTVTPTPSATPT 364
            .:        ||:|...:.|....|.                  :|..:::........||..||
  Rat   297 CA--------KEVSGPVEPGPAFSEC------------------LERRQMLHHAVSYTVPSGLPT 335

  Fly   365 ATPTPTATPTLTPTPTATRTRTPTPTLTP----------TPTPTSTPSSTAIA------------ 407
            ..|.|.:|......|.......| ..|.|          ...||..||...:|            
  Rat   336 GPPPPLSTGPAGSFPCLQLHAGP-DGLCPLQDKVSRDLKASGPTFVPSVGHLADKSHSFQVTEAC 399

  Fly   408 --AGQPAPPPPPPGGAPKQRP-KVKYTKTSAGSKGR-----MQQALNQK---------APAASWS 455
              ||...........||...| .|.|....|.|||.     .:.||:.:         .|.|.:.
  Rat   400 AVAGDGKDRHLDAAMAPDHAPYGVSYAHLKAESKGERRPGGFEAALHPRLKGLEYLSSGPEAPFP 464

  Fly   456 GAKDIYDFKSGSEDEEPIKMVLPSLKELREFSDEDNKPLKLFERQAEKTKVQVQDEE-------- 512
            |      ...|:.|:... ..||:.::....:.:|  ||.....||..|..:|.::|        
  Rat   465 G------LPKGNLDKGGY-FELPTSQDCARSNHQD--PLGGKTTQACCTLDKVANKEAPAGPPGG 520

  Fly   513 --------EQPLVKKE-EKPPSEKEVKVKSKE---------------------------KEKEKE 541
                    :|.||..| |...|..|.|.||.|                           :|::..
  Rat   521 QKVARIRHQQHLVAPEVESGGSGAESKRKSVELASLGYSGHHMPPWGVQTGHDTSMAIIEERKGS 585

  Fly   542 KDVDPLSNAQQSEPAAKHTTSTSTTSTTSITSVKKQAKRKIATPMPSSAGRKKKTVGKG------ 600
            ..:||..:..|..........|.....:::.::.|.:.:.:.      .|:|...||.|      
  Rat   586 AYLDPFGSGLQQAALLSQELPTPQDEVSAMKNLLKYSNQALV------VGQKAPFVGLGGLKASC 644

  Fly   601 -----KAAAAKEP--------------------------PPSGSSAESSSSED--ERKLSAYS-- 630
                 |..|.|.|                          ||.|.:...:..:|  .|..:||:  
  Rat   645 VQQEAKFPATKGPGPVERPDCARSREHEAPTHGDGEVRQPPVGIAVALARQKDTVSRPDAAYNTN 709

  Fly   631 ---------------GPKRHRMASLNALAKVQCLYENESRTAHE-LGLSKATQQPPRIRTLDGSD 679
                           ||:......|.:       .|..||...: |||      |.|...|..:.
  Rat   710 SGRQGRAAPTFKAAGGPRATHTLDLES-------EEERSRACEDRLGL------PGRELLLQDNK 761

  Fly   680 D-----DNHKDSPRHGDTDRDKGSVSPPHT---------SAAP---PAAPIAPPKEAEPRRELRY 727
            |     ..|..|...||.        |||.         ..||   ||.|...|:...|...:  
  Rat   762 DLVEFARIHPSSSCPGDL--------PPHLMMQGGQLGGDPAPHPHPAHPHWLPRTRSPSLWM-- 816

  Fly   728 VPGGRGVG-----------------------KHWEFDSDSETE------------------ELQL 751
              ||...|                       ..:....|:.|:                  |:..
  Rat   817 --GGHSYGLGHPALHQNLPPGFPASVPGSMPSVFPLPQDAATQLVILPSEPTPHTTPHTLAEVMD 879

  Fly   752 QQTL-PPV-----------KKKKLPKKAPPKKVASSETDAKRKKKSVQVEESDDEEAKEKEKEKE 804
            |.:| ||:           ...:||..:..:.:...|..|.:.::..|.::...::.::::::::
  Rat   880 QASLWPPMYGARGPASHMQHPGQLPVYSRSQLLRQQELYALQHQQQQQQQQQQQQQQQQQQQQQQ 944

  Fly   805 KPKPPKQLPKKRKTAFTEELIGDYKGILARKRMASLNASAIVAATYEVERHLDKNLASDCSSFES 869
            :.:..:|..::::...|:.|              .|..:|......| :||::...|:...:.:|
  Rat   945 QQQQQQQQQQQQQHRATQAL--------------ELQRAAQFQRKPE-DRHMELEEAAREKAPKS 994

  Fly   870 YDE---LDTMPTTTSKVTSAAAIKTEVIHIKKEPKESKESLRERERERESERRRERDNELKDSTV 931
            ..:   |..|...|...|:|..:|.       .|.....:|:..........|......|.....
  Rat   995 THKPVALTPMAKGTPSSTTAGLVKL-------SPCCQSPTLKTPASCPTPPPRPSAPCTLPICPT 1052

  Fly   932 GKMSSHSIIEESNDSKYSKETKETNTDTTI----------TTTGYRDSAASTKDAKDCSRPTSSS 986
            |.....|.:..:.|.  |:|.:...||.|.          .:||...|..|...:.|...|.:  
  Rat  1053 GSPGPGSKLPSTKDK--SEEGQRAGTDLTALEPDLPPRLNPSTGVDFSLPSDVHSSDLPDPKT-- 1113

  Fly   987 VVIVQDTDVTITGVYVNASNGAAQEAYCKMQYRVQSSVTEERVLRPGSVEP--PKSYTPLSALS- 1048
               :|.|           :.|...|              ..|...||...|  |::......|| 
  Rat  1114 ---MQTT-----------TPGTRPE--------------PTRTFLPGEPPPCSPRNLEEPGLLSR 1150

  Fly  1049 --------SMLPPGASSGLSEAHSSPPLPVHAAPTGPHVLLPGEHL------SAGMYHAPDLGLH 1099
                    ::|||....||....:..|.|:.    |...|..|:.|      :.|..::...|..
  Rat  1151 TRDATQDLAILPPPVEGGLPPGKAEDPSPLE----GLQALKFGDLLEGGGTEATGQTNSTQGGTQ 1211

  Fly  1100 TEHALPDHHGPPPPSYAAAAAAAAAAAAYHAHQLAPGGGGVLHMHHQHQYAAHAAHAHHYQQAAE 1164
            .|..:  ..|.|.||..|...|....|         |....|......|.|...|.....:...|
  Rat  1212 NERTV--DQGVPQPSLGATPQALEQVA---------GSPVALDKDEGPQKAPDVAQLQEEETQLE 1265

  Fly  1165 YHGGPPPPPHHYGGPPPQGHYGPPPGAPVPVPVAVPNTVTVPPERCDVGSPPPSYRASAYPPPSS 1229
            .:||.....   .|.|...|   ||.|...:...|..||       |:|..|......|..|.:|
  Rat  1266 ENGGDSEVD---WGTPNHSH---PPKALPGLDALVAATV-------DLGDLPDISLPDAQTPAAS 1317

  Fly  1230 VGM---PPPTLGG--GSSAFCAPSPLHHHQH-----------------QH--------------- 1257
            |.:   |.|...|  |.:.....:.|...|.                 ||               
  Rat  1318 VPLGTAPQPHTSGIHGIALLSELADLEIQQQKSELALQEDEDVLAFNLQHLATLATAWSLVEAAS 1382

  Fly  1258 -QQPGPGVGPPHHDPSGYYQPAGPLISPHVIAAPPPPAQVKKLQEEDG---------PVSAAGSP 1312
             ......:..|..||.     .||.::|          :::.||.:|.         |:.||...
  Rat  1383 LDNSVASLQAPAADPD-----RGPRLTP----------RMQILQRKDTWAPKTKPVCPLKAAIDR 1432

  Fly  1313 TQLQQQQAAAEAAAAAADQAAAQSQSQSQGQSHGHAHSHAH---------NPQQAQHPPQ-PQPY 1367
            ...|:.:...:.|.........|.:.....:.|.|....:.         .|::.:|... |...
  Rat  1433 LDTQEVEMRMQLAELQRRYKEKQRELARLQRRHDHEREESSRSPARRGPGRPRKRKHSSSLPALR 1497

  Fly  1368 PAGAVAAAAAAAAAHQGVPYSRSMHAAQMHYSTGYPPN-----YYAPYPG-------EVMCYSPP 1420
            |.|.:|.:.:..|  :.|..|.|:..|::....  ||.     ..:||.|       :|.| ...
  Rat  1498 PGGQLARSDSKKA--KAVRASLSLLCAELRGDE--PPRKRSKLEKSPYTGLQTASSEKVRC-KKS 1557

  Fly  1421 TYPPYFSSKVYQPSHPAHPAAHPQGPPPPGAYRRYPYYQHAGPPPPHELYEQQPPPPPVSSGSVS 1485
            ..|...||.:      ||..|..:           |..:..|.|.....::::...|   .|.: 
  Rat  1558 CGPAELSSSM------AHKVAQLK-----------PKVKSKGLPASLSAFQRKEAAP---GGRI- 1601

  Fly  1486 GPAQQQPPTSSPASVGAAGAGTAGAPSG--SQLVPAHQQQHQQQHLEHYPGPPSYYAGYSPGGGA 1548
                 :...|...||..:||.....|:|  .:.:|..|.|            |:....:..|.|.
  Rat  1602 -----RKKLSRAKSVKVSGAARHPHPNGDSGREMPKFQTQ------------PAVAVAHEAGSGY 1649

  Fly  1549 SAGQCYTRGLQGPYMEYPPQCPCPMPQSCPKN----VHTGPHIGSNIISNIDQSSSCSSSM---- 1605
            .:..|..      .:|         .::.|:.    :|.|..:|.:..|.:...::..:..    
  Rat  1650 DSEDCQA------LLE---------TEAAPREPGLVLHPGAVLGPSPSSVVKMEANQKAKKKKER 1699

  Fly  1606 --LLSATSNSNIGGGSSSSSSSSSSTTLPACSSA--TTTTTASALTTSRGPVK---NVTPNNSNS 1663
              ||.|...|:..|.......:..:...|....|  .....|.....::|..|   ...|.|:.|
  Rat  1700 QGLLGACRLSSPEGEVKIKRRTVKTKVGPKLERAPGRRPPGAPGKKKAKGKAKTGLRAEPGNATS 1764

  Fly  1664 S----GHTSTNSCRSSNNSNNSSNSSCQTIE--MTSWATAATNTTSTTATTATTGTQCQMLVKTE 1722
            .    ..|.|.:||...:...|......|.:  |........|...:.|.:|...        ..
  Rat  1765 RDSLFNPTRTFACREEGSKLASERLKRATRKSAMLQPVLRRKNGALSIALSARNA--------KA 1821

  Fly  1723 LKGENPQVTKMQYEA-----------HVMPPPTPPESYCASDEKLLDD-----------QEQEAE 1765
            :.|::.::||:..||           .::      ||:...|:...||           :|:||.
  Rat  1822 ILGKSRKLTKVNREAVSKQGQGRAVSRLL------ESFAVEDDFEFDDDDDSSFSDEEEEEEEAG 1880

  Fly  1766 LELRLRLGLGLEKSHGGQQHIEAYDLTCSTPPPVTVPQAAAVPRKARI--------------GKS 1816
            ::|.......|.:|    ..|...||....  ||.:|:..::.....:              |:.
  Rat  1881 VQLSEEQSAALARS----CTIHKEDLQDGL--PVLIPKEDSLLYAGSVRTLQPPDIYSIVIEGER 1939

  Fly  1817 MAREMVYAAQQQLLPEKQLKQPKEAAAKLEAEPEMPFVL-------------------------- 1855
            ..|:.:|:. :|||.|          |.|:..|:....|                          
  Rat  1940 GNRQRIYSL-EQLLQE----------AVLDVRPQSSRYLPPGTRVCAYWSQKSRCLYPGNVVRGA 1993

  Fly  1856 KAEIKAETKIKIEHDGEAQASTHISQLPDLKPTIK---TEPEQEL--------EQEAASVPSVAK 1909
            .::.:....:.:|.|........:|.:..|.|..|   |||...|        .::|||      
  Rat  1994 SSDEEDLDSVVVEFDDGDTGHIAVSNIRLLPPDFKIQCTEPSPALLVSSSCRRTKKAAS------ 2052

  Fly  1910 TEPQPEVEVEREQQEPPVDE--EQQPTPG---GSKQRFNLLALSSGNKKTKTNNSYKSLIKQAEP 1969
             |..|..|.......|.|.:  |...|||   |.|.:...:.|.:...|:.|..|...|.::..|
  Rat  2053 -ESHPPSEAPTPSLSPKVQDGPETSKTPGKKSGCKDKAGKVDLLTSGAKSPTGASDHFLGRRGSP 2116

  Fly  1970 -KSYLCPGRRFIRRHGRAPAKYVKRRQMILTQRQQQRMRLQRREQQQQRRQQREAAAEVVAGAV- 2032
             .|:....:  .:|...|.|....:...:|....|.....::...:.........||.|...:. 
  Rat  2117 LLSWSAVAQ--TKRKAVAAAAAGGKGPGVLQNLFQLNGSTKKLRARDTLFPMHSMAAPVFGNSFR 2179

  Fly  2033 ----------VTPSLAGNPIEQAGSEVSIVKDQAPNSSATPSASPKRA--------------RPR 2073
                      .||.|.|......|....:::.:....:....|..:||              .|:
  Rat  2180 ADSFSSLASSYTPFLGGAGAGLPGGAHKLLRAKKAERAEVEKAGRRRAGSEFLVKLDHEGVTSPK 2244

  Fly  2074 KQEIAALHLLE-----GLDTTLSRGYFSDPELNHSSRK-QAPT--AVGGLYAASSPLTTATDHRG 2130
            .:...||.:.:     .|...|:...::.|.|....:| :||.  ...||.....||...:|   
  Rat  2245 NKNCKALLMSDKDFGPKLGRPLASPSYTHPALIGKDKKGRAPVHPLHMGLALRKYPLPCDSD--- 2306

  Fly  2131 KQTTAEKRSKSETKKPPSGESSESGLPCK-KPRKEPAGKVKGKGKKTTAGAAATTIASTAETQTE 2194
                   ...|.:.:...|....:|:|.: ..|...:....|....:::|:.:|:...:::.:  
  Rat  2307 -------CPSSYSDEDEDGPGLATGVPSRFLTRLSMSSSSSGSSTSSSSGSVSTSSLCSSDNE-- 2362

  Fly  2195 AVNAITASNQETNNNEYQTADLQAQKFRECPAVTDAKVAGTATSTSTASQQQNQQHSDEQHQFLV 2259
                   .:..::::|..|..||....|..||:.....|..:..:|.      ..|:..|..|| 
  Rat  2363 -------DSSYSSDDEDPTLLLQTCLTRPVPALLAPPEALRSKGSSP------HAHAHAQRCFL- 2413

  Fly  2260 PSQPATASATAALAATPPPSRQGQATHTKRTRSRCKFGNRK----RQR-----HRPGGVSYELDV 2315
                :.|..|.|.|...|    |.:....:.:....|...|    |||     :|| .:|..|  
  Rat  2414 ----SRAGVTGAGAGAGP----GVSKSKFKRKEALSFSKAKELSRRQRLPSVENRP-KISAFL-- 2467

  Fly  2316 TQPPATKANVVPKWNNGWMWAGKAFQGAVFLNSDDPLVLRTCYPAMRHVEG-DIIRIRDC-VLLK 2378
               ||.:.         |.|:|...|..........|.    |.|:  |.| :.:||.|| |.|.
  Rat  2468 ---PARQL---------WKWSGNPTQRRGMKGKARKLF----YKAI--VRGKETLRIGDCAVFLS 2514

  Fly  2379 ANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGRQRNDCPDEVYASRHRDHNSVACV 2443
            |...| |||:.::..||:: ....|::.:.|:|.||.|..|::::|..:.:|.|.|.|.|.|..:
  Rat  2515 AGRPN-LPYIGRIESLWES-WGSNMVVKVKWFYHPEETKLGKRQSDGKNALYQSCHEDENDVQTI 2577

  Fly  2444 EDKCYVLTFSEYCRYRRRLRAAE-EDVEDVSIV-----PRRPSIATAPGFPV 2489
            ..||.|:...:   |.:.:|..: :|.:|:..:     |....:.||.|.||
  Rat  2578 SHKCQVVGREQ---YEQMMRGRKYQDQQDLYYLAGTYDPTTGRLVTADGVPV 2626

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 41/133 (31%)
Bahcc1XP_008774088.1 BAH_BAHCC1 2501..2620 CDD:240065 35/124 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.