DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and Tnrc18

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:NP_001100593.1 Gene:Tnrc18 RGDID:1307540 Length:2900 Species:Rattus norvegicus

Alignment Length:2961 Identity:556/2962 (19%)
Similarity:895/2962 (30%) Gaps:1005/2962 (34%)


  Fly     7 SNAAERVQRSTATAAAAAAAAAAAATASSTQGKKRPGKQT-KASGGGGDEADDKKSASK------ 64
            |.|.|....:||:..|......|...||:|.|  |||... .|:..|..||...:|..|      
  Rat   465 SRAEEEAAVATASKKAYLDPGGAMPRASATCG--RPGADLHSAAAHGPGEASAMQSLIKYSGSFA 527

  Fly    65 TDSAAKKPA----KDPTGSSGV----------------STATTEGGAGNGGGKQTTSTTTSSTSS 109
            .::.|.:|.    |.|.|..|.                :..|..|....|||:|.........|:
  Rat   528 REAVAVRPGGCGKKSPFGGLGTMKPEPIPTSAGPPRAQARLTHPGVPTAGGGRQLKRDPERPESA 592

  Fly   110 TTAPSASASASASNSLKLSP-------EERHEDGKARAINKML----KSL---DIKIHG------ 154
            .|.....:.|.....::..|       ..:.:.|.:..:...|    :||   ::|.||      
  Rat   593 KTFGREGSGAQGEAEVRHPPVGIAVAVARQKDSGSSSRLGPGLIDQERSLSLNNVKGHGRTEDDC 657

  Fly   155 ------FDNLLPSGEERLNDGVLKSS--ISENVKTKSRAAAVKVISSLNPGKM------------ 199
                  .|.||.:..:|..:.:|:.|  :::..:....:.|.   :.|||..|            
  Rat   658 DRARHREDRLLGTRLDRDQEKLLRESKELADLARLHPTSCAP---NGLNPNLMVTGGPTLAGSGR 719

  Fly   200 ---------------------------------PPVKRVRPSP------------------EPVR 213
                                             ||......:|                  :|..
  Rat   720 WSADPAAHLATHPWLPRSGSTSMWLAGHPYGLGPPSLHQGMAPAFPPGLGGSLPSAYQFVRDPQS 784

  Fly   214 EKVAEKPAEKVLDKEKPKAEQQITPPPAPEESPASKVPKKTVQQAKKAKVESSLVQATVLTTTSA 278
            .::...|::. |.......|:...||..|...|..:.|....||.:....:..|.|..:|.....
  Rat   785 GQLVVIPSDH-LPHFAELMERATVPPLWPALYPPGRSPLHHAQQLQLFSQQHFLRQQELLYLQQQ 848

  Fly   279 ATSAPSSASTSK--HTSTKNPGKKSAHSEQMPKKELSKLAKMG--------KPKKEANLVKSTAR 333
            |..|.....:::  ....|....::...|::.|:.|....|.|        .|:|.|.|      
  Rat   849 AAQALELQRSAQLVQERLKAQEHRTEMEEKITKRGLETTGKAGLSATGPGLLPQKSAGL------ 907

  Fly   334 LPDSNTESVQMELEEIVSTPTVTPTPSATPTATPTPTATPTLTPTPTATRTR--------TPTPT 390
                            .:.||.|...:.:|  .|:|.|:|.     |:.:.:        :..|.
  Rat   908 ----------------ATGPTGTHGKAMSP--PPSPRASPV-----TSLKAKVIQKVEDVSKPPA 949

  Fly   391 LTPTPTPTSTPSSTAIAAGQPAPPPPPPG-----GAPK---QRPKVKYTKTSAG----------- 436
            .|...||:|.|||.     .||.|||.||     .||:   ::..::..|.:..           
  Rat   950 YTYPATPSSHPSSP-----PPASPPPTPGLTRKEEAPENVVEKKDLELEKEAPSPFQALFTDIPP 1009

  Fly   437 ---------SKGRMQQALNQKAPAASWSG-AKDIYDFKSGSE------DEEPIKMVLPSLKELRE 485
                     ..||....|.|...||...| |.|:.....|.|      :::||.:....:.|...
  Rat  1010 RYPFQALPPHYGRPYPFLLQPTAAADADGLAPDVPLPADGPERLALSPEDKPICLSPSKIPEPPR 1074

  Fly   486 FSDEDNKPLKLFERQAEK-TKVQVQDEEEQPLVKKEEKPPSEKEVKVKSKEKEKEKEKDVDPLSN 549
            .|.|:       ||.|:: .|.:::|.||.|    .|.|..|..:.:...|....    |.|...
  Rat  1075 DSQEE-------ERLADREVKAEIEDIEEGP----TELPRLESPLALPVPETMVA----VSPAGG 1124

  Fly   550 AQQS--EPAAKHTTSTSTTSTTSITSVKKQAKRKIATPM---PSSAGRKKKT-VGKGKAAAAKEP 608
            ...|  |..|..|........:.::...:.|:.:|..|.   |..|..:..| :.......|||.
  Rat  1125 CGGSPLEAQALSTAGPGCREPSEVSDFAQVAEPQIELPSRTEPHMAALELGTQLTPEPLVEAKEE 1189

  Fly   609 P---PSGSSAESSSSEDERKLSAYSGPKRHRMASLN------ALAKVQCLYENESRTAHELGLSK 664
            |   |.....|...:|...:.|....|......||.      .:.:.|||         .|...:
  Rat  1190 PVEVPLDVPMEEPVAETGPEDSLPQPPLTEPPPSLELSDCDLPVPEGQCL---------NLEAQE 1245

  Fly   665 ATQQPPRIRTLDGSDDDNHKDSPRHGDTDRDKGSVSPPHTSAAPPAAPIAPPKEAEPRRELRYVP 729
            |...|.....     ::.|.:|...|..|...|..:....:..|.|.|:......        ||
  Rat  1246 AAPAPASTYL-----EETHPESLLPGLDDPLAGMNALAAAAELPQARPLPSLGTG--------VP 1297

  Fly   730 GGRGVGKHWEFDSD----------------SETEELQLQ---QTLPPVKKKKLPKKAPPKKVASS 775
            ||.      :.|:.                ||..||:|.   |.:|..:...:.:.:....:|:|
  Rat  1298 GGE------KLDTAPSLVLEHSFLQGITLLSEIAELELDRRGQEVPGPEPNLVVRPSLESLLAAS 1356

  Fly   776 -----------------------ETDAKRKKKSVQVEES---------DDEEAKE---------- 798
                                   |.::.:|...:|.:|.         :|.:|.|          
  Rat  1357 SHMLKEVLESPLSDSLKNLRLPRELNSNKKYSWMQKKEERMFAMKSSLEDMDALELDFRMRLAEV 1421

  Fly   799 KEKEKEKPKPPKQLPKKRKTAFTEELIGDYKGILARK-----RMASLNASAIVAATYEVERHLDK 858
            :.:.|||.:...:|.::|.:....|   |....|.|:     |..:...||:.......:.|...
  Rat  1422 QRRYKEKQRELVKLQRRRDSGDRHE---DAHRSLTRRGPGRPRKRTHTPSALSPPCKRGKSHSGS 1483

  Fly   859 NLASDCSSFESYDELDTMPTTTSKVTSAAAIKTEVIHIKKEPKESKESLRERERERESERRRERD 923
            ...|..|...| |:.|.          .|.|:..    .|.|:|.:|:|....:.| |..:...|
  Rat  1484 GKLSSKSLLTS-DDYDL----------GAGIRKR----HKGPEEEQEALVSMGKAR-SRNQSWDD 1532

  Fly   924 NELKDSTVG-------KMSSHSIIEESNDSKYSKETKETNTDTTITTTGYRDS-AASTKDAKDCS 980
            :|.....:.       ||||.   :|...||..:....|..|...:...:.|| ....|.:..|.
  Rat  1533 HESSSDFMSQLKIKKKKMSSD---QEQLASKLDRALSLTKQDKLKSPFKFSDSPGGKWKTSGGCG 1594

  Fly   981 R-PTSSSVVIVQDTDVTITGV-----------YVNASNGAAQEAYCKMQ---------------- 1017
            | .|....::.:|......|:           :..||.....|...|.:                
  Rat  1595 RFLTQCDSLLGKDRKALAKGLGLSLKPSREGKHKRASKARKMEGGFKARGQPKSVHSPFASEVSS 1659

  Fly  1018 --YRVQSSVTEERVLRPGSVEPPKSYTPLSALSSMLPPGASSGLSEAHSSP---PLPVHAAPTGP 1077
              |...|...|:.:....|.:.|.|    |.|:|.|     .|:...:|.|   |......|:||
  Rat  1660 HSYNTDSDEDEDLLKNSWSAQGPSS----SKLTSSL-----LGMVAKNSKPATGPKLTKRGPSGP 1715

  Fly  1078 HVLLPGEHLSAGMYHAPDLGLHTEHALPDHHGPPPPSYAAAAAAAAAAAAYHAHQLAPGGGGVLH 1142
            ..|.|.|..|.                       ..|:......|.|.:::       .......
  Rat  1716 RTLKPKEATSR-----------------------KQSFCLLLREAEAHSSF-------SDSSAED 1750

  Fly  1143 MHHQHQYAAHAAHAHHYQQAAEYHGGPPPPPHHYGGPPPQGHYGPPPGAPVPVPVAVPNTVTVPP 1207
            ...|...:.........::..|...|                                       
  Rat  1751 SFDQDDSSEEEEEELEEEEEDEEEEG--------------------------------------- 1776

  Fly  1208 ERCDVGSPPPSYRASAYPPPSSVGMPPPTL---GGGSSAFCAPSPLHHHQHQHQQPGPGVGPPHH 1269
                :|    |||..|.....|     |:|   |.|..|..|.|.|         |.|.||||. 
  Rat  1777 ----IG----SYRLGAGEQALS-----PSLEESGLGLLARFAASAL---------PSPVVGPPL- 1818

  Fly  1270 DPSGYYQPAGPLISPHVIAAPPPPAQVKKLQEEDGPVSAAGSPTQLQQQQAAAEAAAAAADQAAA 1334
                                                     |..||:.:|.|             
  Rat  1819 -----------------------------------------SVVQLEAEQKA------------- 1829

  Fly  1335 QSQSQSQGQS-HGHAHSHAHNPQQAQHPPQPQPYPAGAVAAAAAAAAAHQGVPYSRSMHAAQMHY 1398
              :.:.:.|| .|....:..:..:.:.|.|.   |||.:.....|....|.:.            
  Rat  1830 --RKKEERQSLMGTEFEYTDSESEVKVPKQS---PAGLLRPKKGAGEPGQSLA------------ 1877

  Fly  1399 STGYPPNYYAPYPGEVMCYSPPTYPPYFSSKVYQPSHPAHPAAHPQGPPPPGAYRRYPYYQHAGP 1463
                     ||.||...  |.||.|    .|....|.....|...:|...||.        .|||
  Rat  1878 ---------APVPGTRA--SGPTSP----DKAKLASEKGRKARKIRGSKEPGF--------EAGP 1919

  Fly  1464 PPPHE------------LYEQQPPPPPVSSGSVSGPAQQQPPTSSPASVGAAGAGTAGAPSGSQL 1516
            ....:            |::        :|.:|..|:...|.| .|:..|..||.:....:|.  
  Rat  1920 EASDDDLWTRRRSERIFLHD--------ASAAVQAPSNAAPAT-KPSRCGRGGAPSPRKDTGR-- 1973

  Fly  1517 VPAHQQQHQQQHLEHYPGPPSYYAGYSPGGGASAGQCYTRGLQGPYMEYPPQCPCPMPQSCPKNV 1581
              |..::..::...                |..||...|             .|.|...:.|.: 
  Rat  1974 --AKDRKDPRKKKR----------------GKEAGSAAT-------------LPSPRVSTLPDS- 2006

  Fly  1582 HTGPHIGSNIISNIDQSSSCSSSMLLSATSNSNIGGGSSSSSSSSSSTTLPACSSATTTTTASAL 1646
             ..||.|:  ::...:|.:.:..   ......|.|.|.:.|.       |..|.:|.        
  Rat  2007 -RAPHPGA--LATAKRSKAKARG---KEAKKENRGKGGAVSK-------LMECMAAE-------- 2050

  Fly  1647 TTSRGPVKNVTPNNSNSSGHTSTNSCRSSNNSNNSSNSSCQTIEMTSWATAATNTTSTTATTATT 1711
                   ::..||                   .:||.|..:.:.    ...||....|.|..:  
  Rat  2051 -------EDFEPN-------------------QDSSFSEDEHLP----RGGATERPLTPAPRS-- 2083

  Fly  1712 GTQCQMLVKTELKGE----NPQVTKMQYEAHVMPPPTP--------------PESYCASDEKLLD 1758
               | ::.|.|||..    .|...|:.|..||....:|              |..||.  |:|| 
  Rat  2084 ---C-IIDKEELKDGLRVLIPMDDKLLYAGHVQTVHSPDIYRVVVEGERGNRPHIYCL--EQLL- 2141

  Fly  1759 DQEQEAELELR------LRLGLGLEKSHGGQQ--------------------------------- 1784
               |||.:::|      |..|..: .::..||                                 
  Rat  2142 ---QEAIIDVRPASTRFLPQGTRI-AAYWSQQYRCLYPGTVVRGLLDLEDDGDLITVEFDDGDTG 2202

  Fly  1785 -----HIEA----YDLTCSTP-PPVTVPQAAAVPRKARIGKSMAREMVYAAQQQLLPEKQLKQPK 1839
                 ||..    |.:.|:.| |.:.||.|....||.                    .|...:.|
  Rat  2203 RIPLSHIRLLPPDYKIQCAEPSPALLVPSAKRRSRKT--------------------SKDTGEGK 2247

  Fly  1840 EAAA---------KLEAEPEMPFVLKAEIKAETKIKIEHDGEAQASTHISQLPDLKPTIKTEPEQ 1895
            |.||         |.......|   ..:.||:..:.:|   |..|:..:             |..
  Rat  2248 EGAATGPQEATGGKARGRGRKP---STKAKADRAVVLE---EGAATNEL-------------PSA 2293

  Fly  1896 ELEQEAASVPSVAKTEPQPEVEVEREQQEPPV-DEEQQPTPGGSKQRFNLLALSSGNKKTKTNNS 1959
            .|..|..|.|:..|:.|:|   |::..:.|.. ....||:||                       
  Rat  2294 PLALEPVSTPNSKKSTPEP---VDKRARAPKARSVSVQPSPG----------------------- 2332

  Fly  1960 YKSLIKQAEPKSYLCPG-RRFIRRHGRAPAKYVKRR-QMILTQRQQQRMRLQRREQQQQRR---Q 2019
                    .|....||. ..|......|.|..|... .|..|:.:.::.|.......:..|   :
  Rat  2333 --------PPTFSSCPAPEPFGELPTPATAPLVTMPVTMPATRPKPKKARATEGSGAKGPRRPGE 2389

  Fly  2020 QREAAAEVVAGAVVTPSLAGNPIEQAGSEVSIVKDQAPNS-----------SATP---SASPKRA 2070
            ..|...::....|::|.     .::|...:.:.:|..|.:           |.:|   |:.|...
  Rat  2390 DDELLVKLDHEGVMSPK-----SKKAKEALLLREDPGPGAWPESTGLLSLGSYSPTVGSSEPIAT 2449

  Fly  2071 RPRKQEIAALHLLEGLDTTLS-----RGYFSDPELNHSSRKQAPTAVGGLYAASSPLTTATDHRG 2130
            .|:           |||..|:     ..:::||. |..|..:|.....|  |..|..|:::....
  Rat  2450 WPK-----------GLDGDLTIVNTLNAWYNDPG-NSKSPDKAQAEQDG--AEESETTSSSSSSS 2500

  Fly  2131 KQTTAEKRSKSETKKPPSGESSESGLPCKKPRKEPAGKVKGKGKKTTAGAA--ATTIASTAETQT 2193
            ..:::...|.|.:....||..:|.....:|.|::.    :|.|.:|.:.|:  |::.||::.:.:
  Rat  2501 SSSSSSSSSSSSSSSSSSGSETEGEEDAEKNREDG----RGAGGRTCSAASSRASSPASSSSSSS 2561

  Fly  2194 EAVNAITASNQETNNNEYQTADLQAQKFRECPAVTDAKVAGTATSTSTASQQQNQQHSDE----- 2253
            .:.::.::|:..::::...::...:         :.:..:.:::|:||..:..:....||     
  Rat  2562 SSSSSSSSSSSSSSSSSSSSSSSSS---------SSSSSSSSSSSSSTTDEDSSCSSDDEAAPAP 2617

  Fly  2254 ----QHQFLVPSQ----PATASATA------ALAAT-PPPSRQGQATHTKRTRSRCKFGNRKRQR 2303
                ..|..:|::    |:.|.|:|      |...| |||....|...|.:.:::...|.:.|.:
  Rat  2618 AAGPSTQPALPTKVSKPPSKARASAHSPGKKAPPTTQPPPQPPPQPQQTLQPKTQTGAGAKSRPK 2682

  Fly  2304 HRPGGVSYELDVTQPPATKANVVPKWNNG------------WMWAGKAFQGAVFLNSDDPLVLRT 2356
            .|.|   ..|..|:..| |...:|...|.            |.|.||..|..........|.   
  Rat  2683 KREG---VHLPTTKELA-KRQRLPSVENRPKIAAFLPARQLWKWFGKPTQRRGMKGKARKLF--- 2740

  Fly  2357 CYPAMRHVEG-DIIRIRDC-VLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQG 2419
             |.|:  |.| ::|||.|| |.|.|...| |||:.::..:|:: ....|::.:.|:|.||.|..|
  Rat  2741 -YKAI--VRGKEMIRIGDCAVFLSAGRPN-LPYIGRIQSMWES-WGNNMVVRVKWFYHPEETSPG 2800

  Fly  2420 R------------------------QRNDCPDE-VYASRHRDHNSVACVEDKCYVLTFSEYCRYR 2459
            :                        ||.|..:. :|.|.|.|.|.|..|..||.|:...:   |.
  Rat  2801 KQFHEGQHWDQKSGHNLPAALRASSQRKDFMERALYQSSHVDENDVQTVSHKCLVVGLEQ---YE 2862

  Fly  2460 RRLRAAE-EDVEDV-----SIVPRRPSIATAPGFPV 2489
            :.|:..: :|.|.:     :..|....|.:..|.||
  Rat  2863 QMLKTKKYQDSEGLYYLAGTYEPTTGMIFSTDGVPV 2898

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 43/158 (27%)
Tnrc18NP_001100593.1 BAH_BAHCC1 2748..2892 CDD:240065 39/149 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.