DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and Bahcc1

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:XP_006533486.1 Gene:Bahcc1 MGIID:2679272 Length:2688 Species:Mus musculus

Alignment Length:3037 Identity:563/3038 (19%)
Similarity:919/3038 (30%) Gaps:934/3038 (31%)


  Fly    15 RSTATAAAAAAAAAAAATASSTQ-GKKRPGKQTKASGGGGDEADDKKSASKTDSAAKKPAKDPTG 78
            ||.|.||..|.|..||..|:..| ||..|.....||                .:|:.:...:|..
Mouse    22 RSAAAAARLAPAGPAAQPAAHFQPGKYFPSPLPMAS----------------HTASSRLMGNPPA 70

  Fly    79 SSGVSTATTEGGAGNGGGKQTTSTTTSSTSSTTAPSASASASASNSLKLSPEERHEDGKARAINK 143
            ||.:.:..|     :..|...::..:..|||.:.|:...|..|::.:..|  ..||.......:.
Mouse    71 SSFMGSFLT-----SSLGSAASAHPSGPTSSPSEPAYRGSHPATSQIWFS--HSHEAPAYPRFSG 128

  Fly   144 MLKSLDIKI-----HGFDNLLPSGEERLNDGVLKSSI--------------SENVKTKSRAAAVK 189
            .|.|..:.:     ||..|:| .|:.|.. |..|.:.              :.|.....||....
Mouse   129 SLASTFLPVSHLDHHGNSNVL-YGQHRFY-GTQKDNFYLRNLPPQPTILPANHNFPGVPRATPAH 191

  Fly   190 VISSLNPGKMPPVK---------RVRPSPEPVREKVA------EKPAEKVLDKEKPKAEQQITPP 239
            .|.|.:..::....         |.....|..:|||:      |:||   ::::..|..|::. |
Mouse   192 PIGSCSRDRIEAASLQKGPKEFDRFLMGKEVGKEKVSKGAEGRERPA---VEEDSGKDRQKLV-P 252

  Fly   240 PAPEESP---ASKVPKKTVQQAKKAKVESSLVQATVLTTTSAATSAPSSAS---TSKHTSTKNPG 298
            |.|.|.|   |...|:.:.:...| .:.|.|:...||.......|..|.|.   ....|....||
Mouse   253 PMPAEGPCKEAGPAPRGSCEGRPK-HLTSCLLNTKVLNGDMGKASLASCAGGMLGRPGTGVAAPG 316

  Fly   299 KKSAHSEQMPKKELSKLAKMGKPKKEANLVKSTARLPDSNTESVQMELEEIVSTPTVTPTPSATP 363
            :.:        ||::...:.|....|.                  :|..:::........||..|
Mouse   317 RCA--------KEVAGPVEPGPAFSEC------------------LERRQMLHHAVSYTVPSGLP 355

  Fly   364 TATPTPTATPTLTPTPTATRTRTPTPTLTP----------TPTPTSTPSSTAIA----AGQPAPP 414
            |..|.|.:|......|.......| ..|.|          ...||..||...:|    :.|.|..
Mouse   356 TGPPPPLSTGPAGSFPCLQLHAGP-DGLCPLQDKVSRDLKASGPTFVPSVGHLADKSRSFQVAEA 419

  Fly   415 PPPPG---------------GAPKQRPKVKYTKTSAGSKGR-----MQQALNQK---------AP 450
            ....|               |||.   .|.|....|..||.     .:.||:.:         .|
Mouse   420 CAVAGDGKDRHLDAAMATDHGAPY---GVSYAHLKAEGKGERRPGGFEAALHPRLKGLEYLSSGP 481

  Fly   451 AASWSG-AKDIYDFKSGSEDEEPIKMVLPSLKELREFSDEDNKPLKLFERQAEKTKVQVQDEE-- 512
            .|.:.| .|...| |||..:       ||:.::....:.:|  ||.....||..|..:|.::|  
Mouse   482 EAPFPGLPKGGLD-KSGYFE-------LPTSQDCARSNHQD--PLGGKATQACCTLDKVANKEAP 536

  Fly   513 --------------EQPLVKKE-EKPPSEKEVKVKSKE--------------------------- 535
                          :|.||..| |...|..|.|.||.|                           
Mouse   537 AGPPVGQKVARIRHQQHLVAPEVESGGSGAETKRKSVELASLGYSGHHMPPWGVQTGHDTSMAII 601

  Fly   536 KEKEKEKDVDPLSNAQQSEPAAKHTTSTSTTSTTSITSVKKQAKRKIATPMPSSAGRKKKTVGKG 600
            :|::....:||..:..|..........|.....:::.::.|.:.:.:.      .|:|...||.|
Mouse   602 EERKGSAYLDPFGSGLQQAALLSQELPTPPDEVSAMKNLLKYSNQALV------VGQKAPFVGLG 660

  Fly   601 KAAAAKEPPPSGSSAESSSSEDERKLSAYSGPKRHRMASLNALAKVQCLYENESRTAHELGLSKA 665
                         |.::|..:.|.|..|..||        ..:.:..|....|....|..|   .
Mouse   661 -------------SLKASCVQQEAKFPATKGP--------GPVERPDCARSREHEAPHGDG---E 701

  Fly   666 TQQPP---RIRTLDGSDDDNHKDSPRHGDTDRDKGSVSPPHTSAAPPAAPIAPPKEAEPRR---- 723
            .:|||   .:......|.....|:..:.::.| :|..:|....|..|.|..|...|:|..|    
Mouse   702 VRQPPVGIAVALARQKDTVGRPDTAYNTNSGR-QGRAAPTFKGAGGPRASHALDLESEEERSRAC 765

  Fly   724 -ELRYVPGGRGVGKHWEFDSDSETEELQLQQTLPPVKKKKL------PKKAPPKKVASSETDAKR 781
             |...:||                .||.||.....|:..::      |...||..:......|..
Mouse   766 EERLGLPG----------------RELLLQDNKDLVEFARIHPSSSCPGDLPPHLMMQGGDPAPH 814

  Fly   782 KKKSVQVEESDDEEAKEKEKEKEKPKPPKQLPKKRKTAFTEELIGDYK---GILARKRMASLNAS 843
                                  ..|..|..||:.|..:.   .:|.:.   |..|..:.......
Mouse   815 ----------------------PHPAHPHWLPRTRSPSL---WMGGHSYGLGHPALHQNLPPGFP 854

  Fly   844 AIVAATYEVERHLDKNLASDCSSFESYDELDTMPTTTSKVTSAAAI------------------- 889
            |.|..:......|.::.|:......|.....|.|.|.::|...|::                   
Mouse   855 ASVPGSMPSVFPLPQDAATQLVILPSEPTPHTTPHTLAEVMDQASLWPPMYGARGPASHMQHPGQ 919

  Fly   890 -----------KTEVIHIKKEPKESKESLRERERERESERRRERDNELKDSTVGKMSSHSIIE-- 941
                       :.|:..::::.::.::..::::::::.::::::..:.:......:....:.:  
Mouse   920 LPVYSRSQLLRQQELYALQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHRATQALELQRVAQFQ 984

  Fly   942 --------ESNDSKYSKETKETNTDTTITTTGYRDSAAST---------------KDAKDC---- 979
                    |..::...|..|.|:....:|.......:::|               |....|    
Mouse   985 RKPEDRHMELEEAAQEKTPKSTHKPVALTPMAKGTPSSATAGLVKLSPCCQSPTLKTPASCPTPP 1049

  Fly   980 SRPTSSSVVIVQDTDVTITGVYVNASNGAAQEAY------------------------CKMQYRV 1020
            .||::...:.:..|.....|..|.::...::|..                        ..:...|
Mouse  1050 PRPSAPCTLPICPTGSPGPGSKVPSTMDKSEEGQRAGTNLTTLEPDLTPGLNPTAGLDLSLPSDV 1114

  Fly  1021 QSSVTEE----RVLRPGS-VEPPKSYTP----------------LSALS------SMLPPGASSG 1058
            .||..::    :...||: .|||:::.|                ||...      :.|||....|
Mouse  1115 HSSDLQDPKTMQTTTPGTRPEPPRTFLPGEPPPCSPRNLEEPGLLSRARDATQDLANLPPPVEGG 1179

  Fly  1059 LSEAHSSPPLPVHAAPTGPHVLLPGEHL------SAGMYHAPDLGLHTEHALPDHHGPPPPSYAA 1117
            |....:..|.|:.    |...|..|:.|      :.|..::...|:..|..: |...|.||..|.
Mouse  1180 LPPGKAEDPSPLE----GLQALKFGDLLEGGGTEATGQTNSTQGGMQNERTV-DQGAPQPPLGAT 1239

  Fly  1118 AAAAAAAAAAYHAHQLAPGGGGVLHMHHQHQYAAHAAHAHHYQQAAEYHGGPPPPPHHYGGPPPQ 1182
            ..|....|          |....|......|.....|.....:...|..||.....   .|.|..
Mouse  1240 PQALEQEA----------GSPAALDKREGPQKVPDVAQLQEEETQLEESGGDSEVD---WGTPNH 1291

  Fly  1183 GHYGPPPGAPVPVPVAVPNTVTVPPERCDVGSPPPSYRASAYPPPSSVGMPPPTL--GGGSSAFC 1245
            .|   ||.|...:...|..||       |:|..|.........|.:||.:....|  ..|.....
Mouse  1292 SH---PPKALPGLDALVAATV-------DLGDLPDISLTDPQTPAASVPLSTAPLPHSSGIHGIA 1346

  Fly  1246 APSPLHHHQHQHQQ-------------------------------------PGPGVGPPHHDPSG 1273
            ..|.|...:.|.|:                                     |...:..|..||. 
Mouse  1347 LLSELADLETQRQKSELSMQAEDEDVLAFNLQHLATLATAWSLVEAANLDSPVTSLQAPAADPD- 1410

  Fly  1274 YYQPAGPLISPHVIAAPPPPAQVKKLQEEDG---------PVSAAGSPTQLQQQQAAAEAAAAAA 1329
                .||.::|          :::.||.:|.         |:.||......|:.:...:.|....
Mouse  1411 ----RGPRLTP----------RMQILQRKDTWAPKTKPVCPLKAAIDRLDTQEVEMRMQLAELQR 1461

  Fly  1330 DQAAAQSQSQSQGQSHGHAHSHAH---------NPQQAQHPPQ-PQPYPAGAVAAAAAAAAAHQG 1384
            .....|.:.....:.|.|....:.         .|::.:|... |...|.|.:|.:.:..|  :.
Mouse  1462 RYKEKQRELARLQRRHDHEREESSRSPARRGPGRPRKRKHSSSLPALRPGGQLARSDSKKA--KA 1524

  Fly  1385 VPYSRSMHAAQMHYSTGYPPNY-----YAPYPG-------EVMCYSPPTYPPYFSSKVYQPSHPA 1437
            |..|.|:..|::....  ||..     .:||.|       :|.|...       ..:...||..|
Mouse  1525 VRASLSLLCAELRGDE--PPRKRSKLGKSPYTGLQSVSSEKVRCKKS-------CGQAELPSSVA 1580

  Fly  1438 H------PAAHPQG-PPPPGAYRRYPYYQHAGPPPPHELYEQQPPPPPVSSGSVSGPAQQQPPTS 1495
            |      |....:| |...||::|    :.|.|                 .|.:      |...|
Mouse  1581 HKVAQLKPKVKSKGLPAGLGAFQR----KEAAP-----------------GGRI------QKKLS 1618

  Fly  1496 SPASVGAAGAGTAGAPSGSQLVPAHQQQHQQQHLEHYPGPPSYYAGYSPGGGASAGQCYTRGLQG 1560
            ...||.|:||.....|.|......|:.|.|          |:....:..|.|..:..|  :.|.|
Mouse  1619 RAKSVTASGAARHPHPDGDSGREMHKFQAQ----------PAVAVAHEAGSGYDSEDC--QALLG 1671

  Fly  1561 PYMEYPPQCPCPMPQSCPKNVHTGPHIGSNIISNIDQSSSCSSSMLLSATSNSNIGGGSSSSSSS 1625
                         .::.|:......|.||.:..   ...|.||.:.:.|        ...:....
Mouse  1672 -------------TEAAPREPGLVLHPGSGVAV---LGPSPSSVVKMEA--------NQKAKKKK 1712

  Fly  1626 SSSTTLPACSSAT----------TTTTASALTTSRGPVKNV--TPNNSNSSGH------------ 1666
            .....|.||..::          |..|.......|.|.:..  .|....:.|.            
Mouse  1713 ERQGLLGACRLSSPEGEVKIKRRTVKTKVGAKLERAPGRRPPGAPGKKKAKGKVKTGLRTEPGTA 1777

  Fly  1667 ---------TSTNSCRSSNNSNNSSNSSCQTIE--MTSWATAATNTTSTTATTATTGTQCQMLVK 1720
                     |.|.:||...:...|......|.:  |........|...:.|.:|...        
Mouse  1778 TSRDTLFSPTRTFACREEGSKLASERLKRATRKSAMLQPVLRRKNGALSIALSARNA-------- 1834

  Fly  1721 TELKGENPQVTKMQYEA-----------HVMPPPTPPESYCASDEKLLD----------DQEQEA 1764
            ..:.|::.::||::.||           .::      ||:...|:...|          ::|:||
Mouse  1835 KAILGKSRKLTKVKREAVSKQGQGRAVSRLL------ESFAVEDDFEFDEDDTSFSDEEEEEEEA 1893

  Fly  1765 ELELRLRLGLGLEKSHGGQQHIEAYDLTCSTPPPVTVPQAAAVPRKARI--------------GK 1815
            .::|.......|.:|    ..|...||....  ||.:|:..::.....:              |:
Mouse  1894 GVQLSAEQSAALARS----CTIHKEDLQDGL--PVLIPKEDSLLYAGSVRTLQPPDIYSIVIEGE 1952

  Fly  1816 SMAREMVYAAQQQLLPEKQLKQPKEAAAKLEAEPEMPFVL------------------------- 1855
            ...|:.:|:. :|||.|          |.|:.:|:....|                         
Mouse  1953 RGNRQRIYSL-EQLLQE----------AVLDVQPQSSRYLPPGTRVCAYWSQKSRCLYPGNVVRG 2006

  Fly  1856 -KAEIKAETKIKIEHDGEAQASTHISQLPDLKPTIK---TEPEQE-LEQEAASVPSVAKTEPQPE 1915
             .::.:....:.:|.|........:|.:..|.|..|   |||... |...:......|..|..|.
Mouse  2007 ASSDEEDLDSVLVEFDDGDTGHIAVSNIRLLPPDFKIQCTEPSPALLVSSSCRRTKKAANEGHPP 2071

  Fly  1916 VEVEREQQEPPVDE--EQQPTPG---GSKQRFNLLALSSGNKKTKTNNSYKSLIKQAEPKSYLCP 1975
            .|.......|.|.:  |...|||   |||.:...:.|.:...|:.|..|                
Mouse  2072 SEAPTPSLSPKVPDGPETSKTPGKKSGSKDKAGKVDLLTSGAKSPTGAS---------------- 2120

  Fly  1976 GRRFIRRHGRAPAKYVKRRQMILTQRQQQRMRLQRREQQQQRRQQREAAAEVVAGAVVTPSLAGN 2040
             ..|:.|.| :|                    |.......|.:::..|||...||. ..|.:..|
Mouse  2121 -DHFLGRRG-SP--------------------LLSWSAVAQTKRKAVAAAAAAAGG-KGPGVLQN 2162

  Fly  2041 PIEQAGSEVSI-VKDQ--APNSSATPSASPKRARPRKQEIAALH--LLEGLDTTLSRGYFSDPEL 2100
            ..:..||...: .:|.  ..:|.|||.............:|:.:  .|.|....|..|.......
Mouse  2163 LFQLNGSTKKLRARDTLFPMHSMATPVFGNSFRADSFSSLASSYTPFLGGAGAGLPGGAHKLLRA 2227

  Fly  2101 NHSSRKQAPTAVGGLYAASSPLTTATDHRGKQTTAEKRSKS----------ETKKPPSGES---- 2151
            ..:.|.:|..|  |...|........||.|..:...|..|:          :..:|.|..|    
Mouse  2228 KKAERAEAEKA--GRRRAGGEFLVKLDHEGVTSPKNKNCKALLMSDKDFGPKLGRPLSNPSYAHP 2290

  Fly  2152 -----SESG-----------------LPC--------KKPRKEPAGKVKGKGKK--TTAGAAATT 2184
                 .:.|                 |||        ....::..|...|...:  |....::::
Mouse  2291 ALIGKDKKGRAPVHPLPMGLALRKYPLPCDSDCPSSYSDEDEDGPGLATGVPSRFLTRLSMSSSS 2355

  Fly  2185 IASTAETQTEAVNAITASNQETNNNEYQTAD------LQAQKFRECPAVTDAKVAGTATSTSTAS 2243
            ..|:..:.:.:|:..:..:.:..::.|.:.|      ||....|..||:.....|..:..:|.  
Mouse  2356 SGSSTSSSSGSVSTSSLCSSDNEDSSYSSDDEDPALLLQTCLTRPVPALLAPPEALRSKGSSP-- 2418

  Fly  2244 QQQNQQHSDEQHQFLVPSQPATASATAALAATPPPSRQGQATHTKRTRSRCKFGNRK----RQR- 2303
                ..|:..|..||..:..|.|.|.|:      ||  |..:..|| :....|...|    ||| 
Mouse  2419 ----HAHTHAQRCFLSRAGVAGAGAGAS------PS--GSKSKFKR-KEALSFSKAKELSRRQRL 2470

  Fly  2304 ----HRPGGVSYELDVTQPPATKANVVPKWNNGWMWAGKAFQGAVFLNSDDPLVLRTCYPAMRHV 2364
                :|| .:|..|     ||.:.         |.|:|...|..........|.    |.|:  |
Mouse  2471 PSVENRP-KISAFL-----PARQL---------WKWSGNPTQRRGMKGKARKLF----YKAI--V 2514

  Fly  2365 EG-DIIRIRDC-VLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGRQRND--- 2424
            .| :.:||.|| |.|.|...| |||:.::..||:: ....|::.:.|:|.||.|..|::::|   
Mouse  2515 RGKETLRIGDCAVFLSAGRPN-LPYIGRIESLWES-WGSNMVVKVKWFYHPEETKLGKRQSDGKV 2577

  Fly  2425 -----------CP------------------------------DEVYASRHRDHNSVACVEDKCY 2448
                       ||                              :.:|.|.|.|.|.|..:..||.
Mouse  2578 RCGQVRWGPSPCPGSLGEWALSLGVACFCRGRPRHCMCSLARQNALYQSCHEDENDVQTISHKCQ 2642

  Fly  2449 VLTFSEYCRYRRRLRAAE-EDVEDVSIV-----PRRPSIATAPGFPV 2489
            |:...:   |.:.:|..: :|.:|:..:     |....:.||.|.||
Mouse  2643 VVGREQ---YEQMMRGRKYQDQQDLYYLAGTYDPTTGRLVTADGVPV 2686

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 43/177 (24%)
Bahcc1XP_006533486.1 BAH_BAHCC1 2517..2680 CDD:240065 37/168 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.