DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and Tnrc18

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:XP_006504750.1 Gene:Tnrc18 MGIID:3648294 Length:2951 Species:Mus musculus

Alignment Length:2592 Identity:492/2593 (19%)
Similarity:812/2593 (31%) Gaps:872/2593 (34%)


  Fly     7 SNAAERVQRSTATAAAAAAAAAAAATASSTQGKKRPGKQTKASGGGGDEADDKKSASKTDSAAKK 71
            |.|.|....:||:..|......|...||:|.|  |||....::..|..||...:|..|...:..:
Mouse   516 SRAEEEAAVATASKKAYLDPGGAMPRASATCG--RPGADLHSAAHGPGEASAMQSLIKYSGSFAR 578

  Fly    72 PAKDPTGSSGVSTATTEGGAGNG---GGKQTTSTTTSSTSSTTAPSASA--------SASASNSL 125
            .|          .|...||.|..   ||..|.....:.||: ..|.|.|        :|.....|
Mouse   579 EA----------VAVRPGGCGKKSPFGGLGTMKPEPTPTSA-GPPRAQARLTHPGVPTAGGGRQL 632

  Fly   126 KLSPEE--------------------RH-------------EDGKARAI-------NKMLKSLDI 150
            |..||.                    ||             :.|.:..:       .:.|...::
Mouse   633 KRDPERPESAKAFGREGSGAQGEAEVRHPPVGIAVAVARQKDSGSSSRLGPGLGDQERTLSLNNV 697

  Fly   151 KIHG------------FDNLLPSGEERLNDGVLKSS--ISENVKTKSRAAAVKVISSLNPGKM-- 199
            |.||            .|.||.:..:|..:.:|:.|  :::..:....:.|.   :.|||..|  
Mouse   698 KGHGRTDDECDRARHREDRLLGTRLDRDQEKLLRESKELADLARLHPTSCAP---NGLNPNLMVT 759

  Fly   200 -------------------------------------------PPVKRVRPSP------------ 209
                                                       ||......:|            
Mouse   760 GGPTLAGSGRWSADPAAHLATNPWLPRSGSTSMWLAGHPYGLGPPSLHQGMAPAFPPGLGGSLPS 824

  Fly   210 ------EPVREKVAEKPAEKVLDKEKPKAEQQITPPPAPEESPASKVPKKTVQQAKKAKVESSLV 268
                  :|...::...|::. |.......|:...||..|...|..:.|....||.:....:..|.
Mouse   825 AYQFVRDPQSGQLVVIPSDH-LPHFAELMERAAVPPLWPALYPPGRSPLHHAQQLQLFSQQHFLR 888

  Fly   269 QATVLTTTSAATSAPSSASTSK--HTSTKNPGKKSAHSEQMPKKELSKLAKMG--------KPKK 323
            |..:|.....|..|.....:::  ....|....::...|::.|:.|....|.|        .|:|
Mouse   889 QQELLYLQQQAAQALELQRSAQLVQERLKAQEHRTEMEEKISKRSLETTGKAGLSAAGPGLLPRK 953

  Fly   324 EANLVKSTA--------------RLPDSNTESVQMELEEIVSTP---TVTPTPSATPTATP--TP 369
            .|.|....|              ..|.::.::..::..|.||.|   |...|||:.|::.|  :|
Mouse   954 SAGLANGPAGSHGKAVSPPPSPRASPVTSLKAKVIQKVEDVSKPPAYTYPATPSSHPSSPPPASP 1018

  Fly   370 TATPTL---------------------TPTP-----TATRTRTPTPTLTP--------------- 393
            ..||.|                     ||:|     |....|.|...|.|               
Mouse  1019 PPTPGLTRKEEAPENVVEKKDLELEKETPSPFQALFTDIPPRYPFQALPPHYGRPYPFLLQPAAA 1083

  Fly   394 ---------TPTPTSTPSSTAIAAG------QPAPPPPPPGGAPKQR------------------ 425
                     .|.|...|...|::..      .|:..|.||..:|::.                  
Mouse  1084 SDADGLAPDVPLPADGPERLALSPEDKPICLSPSKIPEPPRDSPEEEQLADREVKAEVEDIEEGP 1148

  Fly   426 --------------PKVKYTKTSAGSKGRM---QQALNQKAPAASWSGAKDIYDFKSGSEDEEPI 473
                          |:.....:.||..|..   .|||:...|     |.::..:....::..|| 
Mouse  1149 TELPPLESPLALPVPETMVAVSPAGGCGGSPLEAQALSTAGP-----GCREPSEVSDFAQVAEP- 1207

  Fly   474 KMVLPSLKELREFSDE---DNKPLKLFERQAEKTKVQVQDEEEQPLVKKEEKPPSEKEVKVKSKE 535
            ::.|||..|.|..:.|   ...|..|.|.:.|..:|.:....|:|..   |..|.:...:....|
Mouse  1208 QIELPSKTEHRMTALELGTQLTPEPLVETKEEPVEVPLDVPMEEPTT---EAGPEDSLPQPSLTE 1269

  Fly   536 KEKEKE-KDVD-PLS-------NAQQSEPAAKHTTSTSTTSTTSI-----------TSVKKQAKR 580
            .:...| .|.| |:.       .||::.||...|.....|.:.|:           .::...|:.
Mouse  1270 PQPSLELSDCDLPVPEGQCLNLEAQEAVPAPASTCYLEETHSESLLPGLDDPLAGMNALAAAAEL 1334

  Fly   581 KIATPMPS-----SAGRKKKTV-------------------------GKGKAAAAKEP----PPS 611
            ..|.|:||     .||.|..|.                         .:|:.||..||    .||
Mouse  1335 PQARPLPSLGPGVPAGEKLDTAPSLVLEHSFLQGITLLSEIAELELDRRGQEAADPEPNLVVRPS 1399

  Fly   612 GSSAESSSSEDERKL--SAYSGP---------------------KRHRMASLNA----------- 642
            ..|..::||...:::  |.:|.|                     |..||.::.:           
Mouse  1400 LESLLAASSHMLKEVLESPFSDPLKNLRLPRELNSNKKYSWMQKKEERMFAMKSSLEDMDALELD 1464

  Fly   643 ----LAKVQCLYENESRTAHELGLSKATQQPPRIRTLDGSD--DDNHKDSPRHGDTDRDK----- 696
                ||:||..|:.:.|...:|.           |..|..|  :|.|:...|.|.....|     
Mouse  1465 FRMRLAEVQRRYKEKQRELVKLQ-----------RRRDSGDRHEDAHRSLARRGPGRPRKRTHTL 1518

  Fly   697 GSVSPP------HTSAAPPAAPI------------------APPKEAEPRRELRYVPGGRGVGKH 737
            .::|||      |:|:...::..                  .|.:|.|   .|..:...|...:.
Mouse  1519 SALSPPCKRGKSHSSSGKLSSKSLLTSDDYDLGAGIRKRHKGPEEEQE---ALMGMGKARSRNQS 1580

  Fly   738 WEFDSDSETEEL-QLQQTLPPVKKKKLPKKAPPKKVASSETD-----AKRKKKSVQVEESDDEEA 796
            |: |.||.::.: ||:     :||||:   |..::..:|:.|     .|:.|.....:.||....
Mouse  1581 WD-DHDSSSDFMSQLK-----IKKKKM---ASDQEQLASKLDRALSLTKQDKLKSPFKFSDGPGG 1636

  Fly   797 KEKE----------------KEKE--------KPKPPKQLPKKRKTAFTEELIGDYKGILARKRM 837
            |.|.                |:::        ..||.:: .|.::.:...::.|.::.....|.:
Mouse  1637 KPKTGGGCGRFLTQYDSLLGKDRKALAKGLGLSLKPSRE-GKHKRASKARKMEGGFQARGQPKSV 1700

  Fly   838 ASLNASAIVAATYEVERHLDKNL------ASDCSSFESYDEL-------DTMPTTTSKVTSAA-- 887
            .|..||.:.:.:|..:...|::.      |...||.:....|       ::.|.|..|:|...  
Mouse  1701 HSPFASEVSSQSYNTDSDEDEDFLKNEWSAQGPSSSKLTSSLLCGMVPKNSKPATGPKLTKRGLA 1765

  Fly   888 ---AIKTEVIHIKKE-----------------------------PKESKESLRERERERESE--- 917
               .:|.:|:..:|:                             .:|.:|.|.|.|.:.|.|   
Mouse  1766 GPRTLKPKVVTSRKQSFCLLLREAEARSSFSDSSEEDSFDQDDSSEEEEEELEEEEEDEEEEGIG 1830

  Fly   918 ------RRRERDNELKDSTVGKMSSH--------------SIIEESNDSKYSKETKETNTDTTIT 962
                  ..:.....|::|.:|.::..              |:::...:.|..|  ||.......|
Mouse  1831 SYRLGAGEQALSPSLEESGLGLLARFAASALPSPVVGPPLSVVQLEAEQKARK--KEERQSLLGT 1893

  Fly   963 TTGYRDSAASTKDAKDCSRPTSSSVVIVQDTDVTITGVYVNA------SNGAAQEAYCKMQYRVQ 1021
            ...|.||.:..|..|.     |::.::.....|...|..:.|      ::|.:.....|:   |.
Mouse  1894 EFEYTDSESEVKVPKQ-----SAAGLLRTKKGVGEPGQSLAAPGPGSRASGPSSPDKAKL---VS 1950

  Fly  1022 SSVTEERVLR----PGSVEPPK-------------------SYTPLSALSSMLP----------- 1052
            ....:.|.:|    ||....|:                   :...:.|.|:..|           
Mouse  1951 EKGRKARKIRGPKEPGFEAGPEASDDDLWTRRRSERIFLHDASAAVQATSNTAPATKPSRCGRGG 2015

  Fly  1053 ---PGASSGLSEAHSSPPLPVHAAPTGPHVLLPGEHLSAGMYHAPDLGLHTEHALPDHHGPPPPS 1114
               |...:|.::....|.........|....||...:|               .|||...|.|.:
Mouse  2016 APSPRKDTGRAKDRKDPRKKKRGKEAGSAATLPPPRVS---------------TLPDSRAPHPGA 2065

  Fly  1115 YAAAAAAAAAAAAYHAHQLAPGGGGVLHMHHQHQYAAHAAHAHHYQQAAEYHGGPPPPPHHYGGP 1179
            .|.|..:.|.|....|.:...|.||.:....:...|.....|:.....:|        ..|.   
Mouse  2066 LATAKRSKAKARGKEAKKENRGKGGAVSKLMECMAAEEDFEANQDSSFSE--------DEHL--- 2119

  Fly  1180 PPQGHYGPPPGAPVP-------------VPVAVP-------------------NTVTVPPERCDV 1212
             |:|.....|..|.|             :.|.:|                   ..|.|..||   
Mouse  2120 -PRGGATERPLTPAPRSCIIDKEELKDGLRVLIPLDDKLLYAGHVQTVHSPDIYRVVVEGER--- 2180

  Fly  1213 GSPPPSY-------RASAYPPPSSVGMPPPTLGGGSSAFCAPSPLHHHQHQHQQPGPGV------ 1264
            |:.|..|       .|.....|:|....|.  |...:|:.:      .|::...||..|      
Mouse  2181 GNRPHIYCLEQLLQEAIIDVRPASTRFLPQ--GTRIAAYWS------QQYRCLYPGTVVRGLLDL 2237

  Fly  1265 -------------GPPHHDPSGYYQPAGPLISP--HVIAAPPPPA--------QVKKLQEEDGPV 1306
                         |.....|..:.:    |:.|  .:..|.|.||        :.:|..::.|.|
Mouse  2238 EDDGDLITVEFDDGDTGRIPLSHIR----LLPPDYKIQCAEPSPALLVPSAKRRSRKTSKDTGEV 2298

  Fly  1307 --SAAGSPTQLQQQQAAAE----AAAAAADQAAAQSQSQSQGQ--SHGHAHSHAHNPQQAQHPPQ 1363
              .||..|.:....:|...    :..|.||:|....:..:..:  |...|......|...:..|:
Mouse  2299 KEGAATGPQEATGGKARGRGRKPSTKAKADRAVVLEEGAATNEVPSAPLALEPISTPNSKKSTPE 2363

  Fly  1364 PQPYPAGAVAAAAAAAAAHQGVPYSRSMHAAQMHYSTGYPPNYYAPYPGEVMCYSPPTYPPYFSS 1428
            |....|.|              |.:||:.|                        .|...||.|||
Mouse  2364 PVDKRARA--------------PKARSISA------------------------QPSPVPPTFSS 2390

  Fly  1429 KVYQPSHPAHPAAHPQGPPPPGAYRRYPYYQHAGPPPPHELYEQQPPPPPVSSGSVSGPAQQQPP 1493
                     .||..|.|..|                        .|...|:.:..|:.||.:..|
Mouse  2391 ---------CPAPEPFGELP------------------------TPATAPLVTMPVTMPATRPKP 2422

  Fly  1494 TSSPASVGAAGAGTAGAPSGSQLV----------PAHQQQHQQQHLEHYPGPPSY--------YA 1540
            ..:.|:.|:...|........:|:          |..::..:...|...|||..:        ..
Mouse  2423 KKARAAEGSGAKGPRRPGEDDELLVKLDHEGVMSPKSKKAKEALLLREDPGPGGWPESTGLLSLG 2487

  Fly  1541 GYSPGGGASAGQC-YTRGLQGPYMEYP-PQCPCPMPQSCPKNVHTGPHIGSNIISNIDQSSSCSS 1603
            .|||..|:|..:. :.:||.|...:.| |..|...|.: .||    |..........::|.:.||
Mouse  2488 SYSPAVGSSEPKATWPKGLDGDLTQEPGPGLPLEDPGN-SKN----PDKAQAEQDGAEESETTSS 2547

  Fly  1604 SMLLSATSNSNIGGGSSSSSSSSSSTT---LPACSSATTTTTASALTTSRGPVKNVTPNNSNSSG 1665
            |...|::|:|:....||||||||.|.|   ..|..:......|...|.|....:..:|.:|:||.
Mouse  2548 SSSSSSSSSSSSSSSSSSSSSSSGSETEGEEDAEKNREDGRGAGGRTCSAASSRASSPASSSSSS 2612

  Fly  1666 HTSTNSCRSSNNSNNSSNSSCQTIEMTSWATAATNTTSTT------------ATTATTGTQCQML 1718
            .:|::|..||::|::||:||..:...:|.::::::::|||            |.....|...|..
Mouse  2613 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTTDEDSSCSSDEEAAPAPAAGPSTQPA 2677

  Fly  1719 VKTELKGENPQVTKMQYEAH---------VMPPPTPPESYCASDEKLLDDQEQE---AELELRLR 1771
            :.|::   :...:|.:..||         ..|||.||    ...::.|..:.|.   |:...:.|
Mouse  2678 LPTKV---SKPPSKARSSAHSPGKKAPTTTQPPPQPP----PQPQQTLQPKTQAGAGAKSRPKKR 2735

  Fly  1772 LGLGL--EKSHGGQQHIEAYDLTCSTPPPVTVPQAAAV------------PRKARIGKSMAREMV 1822
            .|:.|  .|....:|.:         |.....|:.||.            |.:.|..|..||::.
Mouse  2736 EGVHLPTTKELAKRQRL---------PSVENRPKIAAFLPARQLWKWFGKPTQRRGMKGKARKLF 2791

  Fly  1823 YAAQQQLLPEKQLKQPKEAAAKLEA-EPEMPFVLKAEIKAET-------KIKIEHDGEAQASTHI 1879
            |.|   ::..|::.:..:.|..|.| .|.:|::.:.:...|:       ::|..:..|       
Mouse  2792 YKA---IVRGKEMIRIGDCAVFLSAGRPNLPYIGRIQSMWESWGNNMVVRVKWFYHPE------- 2846

  Fly  1880 SQLPDLKPTIKTEPEQELEQEAA-SVPSVAKTEPQPEVEVERE-QQEPPVDEEQQPT 1934
                :..|..:....|..:|::. |:|:..:...|.:..:||. .|...|||....|
Mouse  2847 ----ETSPGKQFHEGQHWDQKSGHSLPAALRASSQRKDFMERALYQSSHVDENDVQT 2899

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065
Tnrc18XP_006504750.1 BAH_BAHCC1 2799..2943 CDD:240065 22/113 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.