DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and BAHD1

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:XP_011519668.2 Gene:BAHD1 HGNCID:29153 Length:832 Species:Homo sapiens

Alignment Length:1060 Identity:246/1061 (23%)
Similarity:360/1061 (34%) Gaps:363/1061 (34%)


  Fly  1586 HIGSNIISNIDQSSSCSSSM-------LLSATSN-SNIGGGSSSSSSSSSSTTLPACSSATTTTT 1642
            |..|.:.|:| |...|...:       |..|||. |.:..|...|.:.:...:||..|       
Human     9 HSSSPLCSSI-QEDLCVFILSVLIPLGLAPATSGLSTLSQGWKYSMTHTRRKSLPMLS------- 65

  Fly  1643 ASALTTSRGP-----------VKNVTPNNSNSSGHTSTNSCRSSNNSNNSSNSSCQTIEMTSWAT 1696
             |.||..|.|           |:.|.|....|.||.          :....|...:...:.....
Human    66 -SGLTGRREPLQMEDSNMEQGVEGVEPGMPESPGHL----------TGRRKNYPLRKRPLVPEKP 119

  Fly  1697 AATNTTSTTATTATTGTQCQMLVKTELKGENPQVTKMQYEAHVMPP--PTPPESYCASDE----- 1754
            .|                |::|: |.|  ||....:...||..:||  |.||....:|::     
Human   120 KA----------------CKVLL-TRL--ENVAGPRSADEADELPPDLPKPPSPAPSSEDPGLAQ 165

  Fly  1755 ---------------KLLDDQEQEAELELRLRLGLGLEKSHGGQQHIE----------------- 1787
                           .||.::|..:.|       .|..:|..|..|..                 
Human   166 PRKRRLASLNAEALNNLLLEREDTSSL-------AGTRRSRAGDPHRSRDRDRATGGWSSSKKRP 223

  Fly  1788 --------AYDLTCSTPPPVTVPQAAAVPRKARIGKSMAREMVYAAQQQLLPEKQLKQPKEAAAK 1844
                    :.||: ..|.|...|:....|...|:....|...:..:|::.||   |:.|: |.|:
Human   224 RLGDLGGGSRDLS-PEPAPDEGPRRDGDPAPKRLASLNAAAFLKLSQERELP---LRLPR-AHAE 283

  Fly  1845 LEAEPEMPFVLKAEIKAETKIKIEH---------DGEAQASTHISQLPD--------LKPTIKTE 1892
            ::.....|...||......|:..::         .|||.........||        ..|::  :
Human   284 VDGRSTEPPAPKAPRPKWPKVNGKNYPKAWQGASSGEAAGPPGWQGCPDEPWPSATPCGPSV--Q 346

  Fly  1893 PEQELEQEAASVP------------SVAKTEPQPEVEVEREQQEPPVDEEQQPTPGGSKQRFNLL 1945
            |..:...:|...|            ..|..:|:|    .|..:|.|..:::...|.....:.:.|
Human   347 PSHQPLSKALESPLGLRPHLPLLMGGQAALKPEP----GRPGEESPAPKQELHQPSFPTPQLSPL 407

  Fly  1946 ALSSGNKKTKTNNSYKSLIKQAEPKS----YLCPGRRFIRRHGRAPAKYVKRRQMILTQRQQQRM 2006
            .: .||..     .|..|....|..:    ||..|:..::..|.:|...:...::          
Human   408 PM-PGNPA-----DYNGLCVGPELTALGSFYLYCGQEGLQCGGYSPCPMLPEGKL---------- 456

  Fly  2007 RLQRREQQQQRRQQREAAAEVVAGAVVTPSL--AGNPIEQ---AGSEVSIVKDQAPNS------- 2059
                          ...||....|.::.||.  :|.|.:.   ..|.....:|...|.       
Human   457 --------------SPVAAPHEEGLLLAPSSVPSGTPFQHPPWGSSRYCSSEDTGVNGYSICGVL 507

  Fly  2060 --SATPSASPKRARPRKQEIAALHLLEGLDTTLSRGYFSDPELNHSSRKQAP---TAVGGLYAAS 2119
              |.|.:.:.....|.|...||    ||. .:|.:..|..||..|.:....|   ..|..:..|:
Human   508 PLSVTHAGTTCGGCPYKMPFAA----EGC-RSLGQLEFPLPEAGHPASPAHPLLGCPVPSVPPAA 567

  Fly  2120 SP---LTTATDHRGKQTTAEKRSKSETKKPPSGESSESGLPCKKPRKEPAGKVKGKGKKTTAGAA 2181
            .|   |.|.|..  .||.|  |:..::.|||||  |:|||                         
Human   568 EPVPHLQTPTSE--PQTVA--RACPQSAKPPSG--SKSGL------------------------- 601

  Fly  2182 ATTIASTAETQTEAVNAITASNQETNNNEYQTADLQAQKFRECPAVTDAKVAGTATSTSTASQQQ 2246
                                                             :...:...|:.:...:
Human   602 -------------------------------------------------RTGSSCRHTARSKAAR 617

  Fly  2247 NQQHSDEQHQFLVPSQPATASATAALAATPPPSRQGQATHTKRTRSRCKFGNRKRQRHRPGGVSY 2311
            ...|         |.||                      ..:|.|.      |:|:|.|      
Human   618 RPSH---------PKQP----------------------RVQRPRP------RRRRRRR------ 639

  Fly  2312 ELDVTQPPATKANVVPKWNNGWMWAGKAFQGAVFLNSDDPLVLRTCYPAM-RHVEGDIIRIRDCV 2375
                              .|||:..|.|.:.||::..:....:|..|.|: ||  |:.||:||.|
Human   640 ------------------TNGWVPVGAACEKAVYVLDEPEPAIRKSYQAVERH--GETIRVRDTV 684

  Fly  2376 LLKAN-EDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGR---QRNDCPDEVYASRHRD 2436
            |||:. .....|||||::.||:|||.||:||||||||||||...||   ......:||:||||:|
Human   685 LLKSGPRKTSTPYVAKISALWENPESGELMMSLLWYYRPEHLQGGRSPSMHEPLQNEVFASRHQD 749

  Fly  2437 HNSVACVEDKCYVLTFSEYCRYRRRLRAAEEDV--EDVSIVPRRPSIATAPGFPVRTVPEHTNPE 2499
            .|||||:|:|||||||:||||:....:...|.:  ...::||.....:|.|.   |||||.|:||
Human   750 QNSVACIEEKCYVLTFAEYCRFCAMAKRRGEGLPSRKTALVPPSADYSTPPH---RTVPEDTDPE 811

  Fly  2500 LVMFCRRAYEFRTRRLLKLP 2519
            ||..||..|:||..|:||.|
Human   812 LVFLCRHVYDFRHGRILKNP 831

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 82/159 (52%)
BAHD1XP_011519668.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005597
OrthoInspector 1 1.000 T1075020
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46576
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5045
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.