DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and Bahd1

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:XP_006499328.1 Gene:Bahd1 MGIID:2139371 Length:781 Species:Mus musculus

Alignment Length:871 Identity:231/872 (26%)
Similarity:329/872 (38%) Gaps:235/872 (27%)


  Fly  1715 CQMLVKTELKGENPQVTKMQYEAHVMPP--PTPPESYCASDE--------------------KLL 1757
            |::|: |.|  ||....:...||..:||  |.||....:|::                    .||
Mouse    79 CKVLL-TRL--ENVAGPRSADEADELPPDLPKPPSPTSSSEDAGLVQPRKRRLASLNAEALNNLL 140

  Fly  1758 DDQEQEAELELRLRLGLGLEKSHGGQQHIEAYDLTCSTPPPVTVPQAAAVPRKARIGKSMAREMV 1822
            .::|:.:.|       .|..:|.||..|......|.|.      ..:...||...:|:. :|:: 
Mouse   141 LEREETSSL-------AGARRSRGGDPHRSRDRATGSW------SFSKKRPRLGDLGEG-SRDL- 190

  Fly  1823 YAAQQQLLPEKQLKQ-----PKEAAA-------KLEAEPEMPFVLKAEIKAETKIKIEHDGEAQA 1875
               ..:|.|::..::     ||..|:       ||..|.|:|.       ..::.:.|.||.   
Mouse   191 ---SPELAPDEGARRDGDPAPKRLASLNAAAFLKLSQERELPL-------RPSRAQAEADGR--- 242

  Fly  1876 STHISQLPDLKPTIKTEPEQELEQEAASVPSVA--KTEPQPEVEVEREQQEPPVDEEQQPT---P 1935
            ||.......|:|.:..:...:..|.|.|..:..  ..:.||.   ||....||.....||:   |
Mouse   243 STEPLAPRILRPKVNGKNCPKARQGAGSGEATGPPNWQEQPN---ERWPSAPPHGPPTQPSHQAP 304

  Fly  1936 GGSKQ---RFNLLALSSGNKKTKTNNSYKSLIKQAEPKSYLCPGRRFIRRHGRAPAKYVKRRQMI 1997
            |.:.:   |.||..|..|....|           .||..   ||.       .:||         
Mouse   305 GKALENPLRPNLPLLMGGQAALK-----------PEPGR---PGE-------ESPA--------- 339

  Fly  1998 LTQRQQQRMRLQRREQQQQRRQQREAAAEVVAGAVVTP-SLAGNPIEQAGSEVSIVKDQAPNSSA 2061
                           .:|:..|....|.:      ::| .:.|||.:.:|               
Mouse   340 ---------------PKQELHQPSFPAPQ------LSPLPMPGNPADYSG--------------- 368

  Fly  2062 TPSASPKRARPRKQEIAAL---HLLEGLDTTLSRGYFSDPELNHSSRKQAPTAV--GGLYAASSP 2121
             |...|        |:.||   :|..|.|......|...|.|...  |.:|.|.  .||..|.|.
Mouse   369 -PCGGP--------ELTALGSFYLYCGQDGLQCGAYSPCPMLPEG--KLSPVAAPNEGLLMAPSS 422

  Fly  2122 LTTATDHRGKQTTAEKRSKSETKKPPSGESSESGLPCKKPRKEPAGKVKGKGKKTTAGAAATTIA 2186
            :.:....:....:|.:...|| ....:|.|....||.....   .|        ||.|.....:.
Mouse   423 VPSGVPFQHPPWSAPRYCSSE-DTGANGYSICGVLPLSLTH---IG--------TTCGGCPYKMP 475

  Fly  2187 STAETQTEAVNAITASNQETNNNEYQTADL-----QAQKFRECPAVTDAKVAGTATSTSTASQQQ 2246
            .|||           ..:.....|:...:.     .|.....||..:....|.......|..   
Mouse   476 FTAE-----------GCRSLGQLEFPLPEAGHPASPAHPLLGCPVPSVPPAAEPIPHLQTPI--- 526

  Fly  2247 NQQHSDEQHQFLVPSQPATASATAALAATPPP-SRQGQATHTKRTRSRCKFGNRKRQRHRPGGVS 2310
                          |:|.|.:.....:|.||. |:.|     .||.|.|:...|.:...||.   
Mouse   527 --------------SEPQTVARACPQSAKPPSGSKSG-----LRTGSSCRHAVRSKAARRPS--- 569

  Fly  2311 YELDVTQPPATKANVVP-----KWNNGWMWAGKAFQGAVFLNSDDPLVLRTCYPAM-RHVEGDII 2369
               ...||.|.:..  |     :..|||:..|.|.:.||::..:....:|..|.|: ||  |:.|
Mouse   570 ---HPKQPRAQRPR--PRRRRRRRTNGWVPVGAACEKAVYVLDEPEPAIRKSYQAVERH--GETI 627

  Fly  2370 RIRDCVLLKAN-EDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGR---QRNDCPDEVY 2430
            |:||.||||:. .....|||||::.||:|||.||:||||||||||||...||   ......:||:
Mouse   628 RVRDTVLLKSGPRKTSTPYVAKISALWENPESGELMMSLLWYYRPEHLQGGRSPSMHEPLQNEVF 692

  Fly  2431 ASRHRDHNSVACVEDKCYVLTFSEYCRYRRRLRAAEEDV--EDVSIVPRRPSIATAPGFPVRTVP 2493
            ||||:|.|||||:|:|||||||:||||:....:...|.:  ...::||.....:|.|.   ||||
Mouse   693 ASRHQDQNSVACIEEKCYVLTFAEYCRFCAMAKRRGEGLPSRKTALVPPSADYSTPPH---RTVP 754

  Fly  2494 EHTNPELVMFCRRAYEFRTRRLLKLP 2519
            |.|:||||..||..|:||..|:||.|
Mouse   755 EDTDPELVFLCRHVYDFRHGRILKNP 780

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 82/159 (52%)
Bahd1XP_006499328.1 Patatin_and_cPLA2 <250..363 CDD:299702 33/167 (20%)
BAH_BAHCC1 624..734 CDD:240065 60/110 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005597
OrthoInspector 1 1.000 T1085125
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46576
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5045
TreeFam 1 0.960
65.990

Return to query results.
Submit another query.