DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and bahd1

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:XP_012824784.1 Gene:bahd1 XenbaseID:XB-GENE-1008672 Length:797 Species:Xenopus tropicalis

Alignment Length:1030 Identity:233/1031 (23%)
Similarity:341/1031 (33%) Gaps:362/1031 (35%)


  Fly  1600 SCSSSMLLSATSNSNIGGGSSSSSSSSS----STTLPACSSATTTTTASALTTSRGPVKNVTPNN 1660
            :|.|.:       |::|.|..|.....:    ....||.:..|.|...:.|....|         
 Frog    19 ACQSRI-------SSVGRGILSKDIRKAYPLRRRLSPAMNEKTCTVVLTRLEDVAG--------- 67

  Fly  1661 SNSSGHTSTNSCRSSNNSNNSSNSSCQTIEMTSWATAATNTTSTTATTATTGTQCQMLVKTELKG 1725
                      ||.....|....|.||       |..             ..||         ||.
 Frog    68 ----------SCIMEGQSGAQPNISC-------WVD-------------DFGT---------LKV 93

  Fly  1726 ENPQVTKMQYEAHVMPPPTPPESYCASDEKLLDDQEQE----AELELRLRLGLGLEKSHGGQQHI 1786
            .....:|||   .|.|.........:|.:.:.|..|..    |.|.......|..|:..|     
 Frog    94 HTGHSSKMQ---RVTPKGKRYSGVTSSMDNIRDFPEPRKRRLASLNAEAVNNLLFERDDG----- 150

  Fly  1787 EAYDLTCSTPPPVTVPQAAAVPRKAR--IGKSMAREMVYAAQQQLLPEKQLKQPKEAAAKLEAEP 1849
                  ||              ||.|  .||:....:.......|.|...| ..|.:..:..|..
 Frog   151 ------CS--------------RKIRKDFGKASENGISDEGWTNLKPNCHL-HSKRSRQRCMASG 194

  Fly  1850 EMP-FVLKAEIKAETKIKIEHDGEAQASTHISQLPDLKPTIKTEPEQELEQEAASVPSVAKTEPQ 1913
            ::| .|.::|:|.|.|:             :|..|..|             ..||:.:||..:..
 Frog   195 QLPDEVFESEMKVEDKV-------------VSYSPAPK-------------RLASLNAVAFLKLT 233

  Fly  1914 PEVEVEREQQEPPVDEEQQPTPGGSKQRFNLLALSSGNKKTKTNNSYKSLIKQAEPKSYLCPGRR 1978
            .|.:...:|:.....:..:...|.||            .|.|||.|:|.                
 Frog   234 SERDHPLKQRSKSDGDTSRSITGCSK------------SKLKTNKSHKK---------------- 270

  Fly  1979 FIRRHGRAPAKYVKRRQMILTQRQQQRMRLQRREQ----QQQRRQQREAAAEVVAGAVVTPSLAG 2039
                      ..||.::.:|.::.:.....|....    :.:.|...:::.:.          .|
 Frog   271 ----------NCVKSKKELLHRKMEDHHGWQEGGDHGILKPEHRNSSKSSGKT----------EG 315

  Fly  2040 NPIEQA-----GSEVSIVKDQAPNSSATPSASPKRARP------RKQE-------IAALH----- 2081
            ..:|::     |||  .:..:.|......|..|:..||      .||:       :..||     
 Frog   316 VHVERSSNNYDGSE--SLYHRLPLMGGQASMKPEYGRPGEKSPTPKQDFQQPSFPVQQLHHLPVP 378

  Fly  2082 --------LLEGLDTTLSRG-------------------------YFSDP----ELNHSSRKQAP 2109
                    |....|.|.|.|                         .|..|    ||..|.....|
 Frog   379 GSLTDCVCLCHPSDITSSDGTYISYGQSGLPYSGYCDFSMYPKDELFPQPVPCEELLVSQSSFPP 443

  Fly  2110 TA-VGGL------YAASSPLTTATD----------HRGKQTTAEKRSKSETKKPPSGESSES--- 2154
            :. :|.|      |:......|.||          .|...|..|.:|.| .|||.:.|..:|   
 Frog   444 SGMIGHLPWCTSRYSFGEDTGTNTDSLCGLIRLPISRVTNTHMEHKSYS-FKKPFTAEGYKSHDQ 507

  Fly  2155 ---GLPCKKPRKEPAGKVKGKGKKTTAGAAATTIASTAETQTEAVNAITASNQETNNNEYQTADL 2216
               .:|.......||..:        .|....::...||         ...|.:|.|:|.||..:
 Frog   508 LSLSIPTAGHPVSPAHPL--------LGCPVPSVPPAAE---------PVPNLQTPNSEPQTMAM 555

  Fly  2217 QAQKFREC------PAVTDAKVAGTATSTSTASQQQNQQHSDEQHQFLVPSQPATASATAALAAT 2275
             .:..|||      |:.:.:.|..|:.....:|.:.::.||.       |.|             
 Frog   556 -LKTARECPQSSKPPSGSKSGVRNTSGCFHASSNKASKSHSH-------PKQ------------- 599

  Fly  2276 PPPSRQGQATHTKRTRSRCKFGNRKRQRHRPGGVSYELDVTQPPATKANVVPKWNNGWMWAGKAF 2340
                   |..|.:|:                                       .||||..|.|.
 Frog   600 -------QRIHRRRS---------------------------------------TNGWMPVGAAC 618

  Fly  2341 QGAVFLNSDDPLVLRTCYPAMRHVEGDIIRIRDCVLLKAN-EDNELPYVAKVAHLWQNPEDGEMM 2404
            :.||::.::....||..|.|:.. .|:|||:||.||||:. ....:|||||::.||:.|:.||:|
 Frog   619 EKAVYVVNEPEPALRRSYQAVER-NGEIIRVRDTVLLKSGPRKKSMPYVAKISALWEEPKTGELM 682

  Fly  2405 MSLLWYYRPEHTDQGRQRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEYCRYRRRLRAAEEDV 2469
            |||.||||||||..||..:....|::||||:|.||:||:|:|||||||:||||:...::...|. 
 Frog   683 MSLFWYYRPEHTQGGRNPSMHQKEIFASRHQDENSIACIEEKCYVLTFAEYCRFCALVKRRGEG- 746

  Fly  2470 EDVSIVPRRPSIATAPGFPV-----RTVPEHTNPELVMFCRRAYEFRTRRLLKLP 2519
                 .|.|.::...|....     |.||:.|:||||..||..|:||..|:||.|
 Frog   747 -----CPNRKALIVPPSAEYSTPSHRRVPDSTDPELVFLCRHVYDFRHGRILKNP 796

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 76/159 (48%)
bahd1XP_012824784.1 BAH_BAHCC1 643..750 CDD:240065 58/113 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005597
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.