DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and tnrc18

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:XP_017952853.1 Gene:tnrc18 XenbaseID:XB-GENE-6458544 Length:2877 Species:Xenopus tropicalis

Alignment Length:2912 Identity:494/2913 (17%)
Similarity:870/2913 (30%) Gaps:996/2913 (34%)


  Fly     8 NAAERVQRST--ATAAAAAAAAAAAATASSTQGKKRPGKQTKASGGGGDEADD------------ 58
            |..|.:..||  .|:|.......:.:.|..|...:..||: .|.||.|....|            
 Frog   530 NGTESLNPSTLGETSAMQNLIKYSGSFAKETAAWQGGGKK-NAFGGLGTMKSDTVDFNNVKNQQC 593

  Fly    59 -KKSASKTD----SAAKKPAKDPTGSSG------------VSTATTEGGAGNGGGKQTTSTTTSS 106
             ..|..|.|    .:||...::..|:.|            |:.|..:..:|            |.
 Frog   594 LSHSGGKRDPERSESAKSFGREVIGAQGEVEVRHPPVGIAVAVARQKDNSG------------SK 646

  Fly   107 TSSTTAPSASASASASNSLKLSPEERHEDGKARAINKMLKSLDIK----------IHGFDNLLP- 160
            |.|:..|            :.|.|..||..:.|....::..|:.:          ...|..:.| 
 Frog   647 TGSSKGP------------EQSEENGHEQIRHREDRLLMGRLECEQEKLLRERKDFADFSRIHPT 699

  Fly   161 -SGEERLNDGV-------LKSSISENVKTKSRAAAVKVISSLNPGKMPPVKRV-RP---SPEPVR 213
             ||...||..:       |.::......:.|:.||.   :..:.|..||:... .|   |.:.:.
 Frog   700 GSGANGLNSNLMVTGGPTLNTTGHWPADSTSQLAAQ---TWFHRGTTPPMWFTGHPYGFSHQTLH 761

  Fly   214 EKVAE--KPAEKVLDKEKPKAEQQITPPPAPEESPASKVPKKTVQQAKKAKVESSLVQATVLTTT 276
            :.::.  .|.   :....|.|.|.:..   |:......||.:.:...:.....|:|.||....|.
 Frog   762 QGLSGTFTPG---MTSSLPSAYQFVRD---PQTGQIVVVPSEQLSHFEILDRSSALWQAMYSPTR 820

  Fly   277 SAATSAPSSASTSKHTSTKNP-----GKKSAH-----------------SEQMPKKELSKLAKMG 319
            |:...|......|:....:..     .:::||                 |.|:...||.:.|::.
 Frog   821 SSLQHAHQLQLLSQQQLLRQHELYMLQQQAAHALELQRSAQLDALELQRSAQLDALELQRSAQLD 885

  Fly   320 --KPKKEANL----VKSTARLPDS-----------------NTESVQMELEE----IVSTPTVTP 357
              :.::..||    ::.|:.|.:|                 ||.:.:..||.    :..|..:..
 Frog   886 ALELQRTVNLDALDLQRTSPLVESFKVYEQQTEVENKIAKQNTGTCKQRLESHPNLLKQTVLLPS 950

  Fly   358 TPSATPTATPTPTATPTLTPTPTATRTRTPTPTLTPTPTPTSTPSSTAIAAGQPAPPPP----PP 418
            .||:...:..:|..:|...|....|:           ..||.......::...|:..||    ||
 Frog   951 APSSYSKSLSSPPLSPKAIPKSEHTQ-----------EGPTQEEHYEYLSNSHPSTTPPESSLPP 1004

  Fly   419 GGAPKQRPKVKYTKTSAGSKGRMQQALNQKAPAASWSGAKDIYDFKSGSE-------------DE 470
            ......|..:...:....|...      :|...:|::|.  :.|..||.:             ..
 Frog  1005 TALIATREDICDEEAEKNSTDM------EKGSTSSFTGL--LTDLSSGFQFSPISPSFENHAYPV 1061

  Fly   471 EP----------IKMVLPSLKELREFSDEDNKPLKLFERQAEKTKVQVQDEEEQPLVKKE----- 520
            :|          :.:.||::|::...|:.:...|.:.:....:.....:.:..:.|:..|     
 Frog  1062 QPTSGPNVACSNLDLPLPAVKKMENTSEANTNQLVISKLLEPEVPASAEKKPSETLLNSETLNHQ 1126

  Fly   521 ------------EKPPSEKEVKVKSKEKE-KEKEKDVDPLSNAQ----QSEPAAKHTTSTSTT-S 567
                        |....|.::::|::... .:|:....|:....    :|....|.|.||.|. |
 Frog  1127 TLCISSADEISAEDAEYEHDLQLKNETSNFNDKKYQEQPVCETDCFSVRSLKPGKETCSTQTDFS 1191

  Fly   568 TTSITSVKKQAKRKIATP----MPSSAGRKKKTVGKGKAAAAKEPPPSGSSAESSSSEDERKLSA 628
            ::.|||.|.|....|.:.    .||:..||.....:.:.:|...|......:::..||.::  ..
 Frog  1192 SSFITSDKCQVNLVIHSQSSEIFPSTNDRKILNTLRNEESAHSIPVVMRPISDTKFSEMDK--VT 1254

  Fly   629 YSGPK--------RHRMASLNALAKVQCLYENESRTAHELGLSKATQQPPRIRTLDGSDDDNHKD 685
            |..|:        ...:|.:|||.                   .||:.|              :.
 Frog  1255 YELPRTIPMDIIAEDPLAGMNALV-------------------AATEMP--------------EA 1286

  Fly   686 SPRHGDTDRDKGSVSPPHTSAAPPAAPIA---PPKEAEPRRELRYVPGGRGVGKHWEFDS----- 742
            ||:   ..:||  :..|..:..|....||   ...|.|..:..:.:...:........:|     
 Frog  1287 SPQ---VSKDK--LFLPDINTNPVLQGIALLSEMAEIELEKRKKELENQQNCHSQTSLESLLAAS 1346

  Fly   743 -------------DS-ETEELQLQQTLPPVKKKK-LPKKAPPKKVASS-------ETD------- 778
                         || :.|.:||.:.|.|.||.. :.|:.....:.||       |.|       
 Frog  1347 SQMLMEVLSCPVLDSLKAESIQLPRELNPDKKYSWMQKRDETFSIRSSIENMDSVELDYRLRLAE 1411

  Fly   779 -----AKRKKKSVQVEESDDEEAKEKEKEKEKPKPPKQLPKKRKTAFTEELIGDYKGILARKRMA 838
                 .:::::..:::...|.|.|:.||.....:.....|:|||                     
 Frog  1412 LQRMYKQKQRELTKLQRRRDSEEKQDEKNINLARRGPGRPRKRK--------------------- 1455

  Fly   839 SLNASAIVAATYEVERHLDKNL-ASDCSSFESYDEL--DTMPTTTSKVTSA------AAIKTEVI 894
              :.::.:.:..|.||...||: ...|..|....|:  |.:....:.:..|      ..||..:.
 Frog  1456 --HETSSMCSHLERERSETKNIKLKKCLLFSEDSEVGEDVLRRQMNVIEDAMIENVGGKIKNRIR 1518

  Fly   895 HIKKEPKESKES--LRERERERESERRRERDNELKDSTVGKMSSHSI-------IEESNDSKYSK 950
            ..:.:.:.|..:  :..:.|:::....:|..|:| |.::......::       .......||..
 Frog  1519 SWEDDARASSYTCEVLTQSRKKQKSSNQELANKL-DKSLSFTKQENVKSKFKFAFSSGGSQKYEG 1582

  Fly   951 ETKETNTDTTITTTGYRDSAA-------STKDAKDCSRPTSSSVVIVQDTDVTITGVYVNASNGA 1008
            .:|.      :|||.::::..       |.:.........:..|::      .:.| .:|.|:..
 Frog  1583 NSKH------LTTTEFKENKTLRFPMLISNEGKNKMVSKVNMHVIL------KVKG-QINTSHSP 1634

  Fly  1009 AQEAYCKMQYRVQSSVTEERVLRPGSVEPPKSYTPLSALSSMLP------PGASSGLSEAHSS-- 1065
            |........|...:. .||..||...|.|..|....|::.||||      .|.......|.||  
 Frog  1635 AFSEISNYSYYTDTE-EEEDYLRNELVSPSNSRLVQSSMYSMLPRRIKMTRGCLQSTERAISSCS 1698

  Fly  1066 -PPLPVHAAPTGPHVLLPGEHLSAGMYHAPDLGLHTEHALPDH--------HGPPPPSYAAAAAA 1121
             .....:.:......||....:.:....:.:..:..:....:.        |.|.|         
 Frog  1699 TVKTKQNCSKNKQLSLLQDAEVRSSFSDSTEDSIDQDFTSEEEDCVNYGTDHLPSP--------- 1754

  Fly  1122 AAAAAAYHAHQLAPGGGGVLHMHHQHQYAAHAAHAHHYQQAAEYHGGPPPPPHHYGGPPPQGHYG 1186
                      .:...|.|:|        |..||.                               
 Frog  1755 ----------NMDESGLGLL--------ARFAAS------------------------------- 1770

  Fly  1187 PPPGAPVPVPVAVPNTVTVPP-----------------ERCDVGS------PPPSYRASAYPPPS 1228
                       .:||.||..|                 .:|.:||      .....:....|.||
 Frog  1771 -----------VLPNPVTSSPISIIQLEAKQKAKKKEERQCLIGSEFQYSDSERELKVVRNPSPS 1824

  Fly  1229 SV---------GMPPPTLGGGSSAFCAPSPLHHHQHQHQQPGPGVGPPHHDPSGYYQPAGPLISP 1284
            :|         .:|..|    ....|..|                           ...|.::. 
 Frog  1825 TVLTSSLEVESALPVLT----EEETCVKS---------------------------LKKGSIMD- 1857

  Fly  1285 HVIAAPPPPAQVKKLQEEDGPVSAAGSPTQLQQQQAAAEAAAAAADQAAAQSQSQSQGQSHGHAH 1349
                   .|.::||.:          ||..|.::                ..|..|.....|...
 Frog  1858 -------RPRKIKKFK----------SPRNLSEE----------------FGQEVSDDDQWGRRR 1889

  Fly  1350 SHAHNPQQAQHPPQPQPYPAGAVAAAAAAAAAHQGVPYSRSMHAAQMHYSTGYPPNYYAPYPGEV 1414
            |.......|.:|....|.|...|.:            .|:|....:|...:....|....:    
 Frog  1890 SERIFLNDAVNPSSLLPVPTNDVNS------------MSKSNRYTKMATVSPKKGNQRKDH---- 1938

  Fly  1415 MCYSPPTYPPYFSSKVYQPSHPAHPAAHPQGPPPPGAYRRYPYYQHAGPPPPHELYEQQPPPPPV 1479
             |        .||::.: |..|.....|.:...|.   ||                         
 Frog  1939 -C--------KFSTQAW-PLQPTGDTRHGEKGEPG---RR------------------------- 1965

  Fly  1480 SSGSVSGPAQQQPPTS-SPASVGAAGAGTAGAPSGSQLVPAHQQQHQQQHLEHYPGPPSYYAGYS 1543
              |....|.:|...|. :..|:...|..|   ||....:....::|:::                
 Frog  1966 --GRWQTPTRQTKMTEINICSLNVKGLNT---PSKRYKLCREMKRHKKK---------------- 2009

  Fly  1544 PGGGASAGQCYTRGLQGPYMEYPPQCPCPMPQSCPKNVHTGPHIGSNIISNIDQSSS--CS-SSM 1605
                        :|     .|..|.|..|           ...:.|..:|.::.:||  || .:.
 Frog  2010 ------------KG-----KELMPSCLSP-----------NGTLASVSVSRLNMTSSVTCSRKTK 2046

  Fly  1606 LLSATSN---SNIGGGSSSSSSSSSSTTLPACSSATTTTTASALTTSRGPVKNVTPNNSNS-SGH 1666
            |.|.|.:   .|.|.|.:                      .|.|..|....::..||..:| |..
 Frog  2047 LKSKTKDMKKENRGKGGA----------------------VSKLMESMAAEEDFEPNQDSSFSED 2089

  Fly  1667 TSTNSCRSSNNSNNSSNSSCQTIEMTSWATAATNTTSTTATTATTGTQCQMLVKTELKGE----N 1727
            .:...|......|..:..||                              ::.|.|||..    .
 Frog  2090 ENVPLCLHPERPNTPAPRSC------------------------------IIDKEELKDGLRVLI 2124

  Fly  1728 PQVTKMQYEAHVMPPPTP--------------PESYCAS---DEKLLD----------------- 1758
            |...|:.|..||....:|              |..||..   .|.::|                 
 Frog  2125 PMDDKLLYAGHVQTVHSPDIYRVIIEGERGNRPHIYCQEQLLQEAIIDVKPPSIRFLPEGTRIAA 2189

  Fly  1759 -------------------DQEQEAELELRLRLGLGLEKSHGGQ---QHIEA----YDLTCSTP- 1796
                               ||:::::|     :.:..:....|:   .||..    |.:.|:.| 
 Frog  2190 YWSQQYRCLYPGTVVQGSLDQKEDSDL-----ITVEFDDGDTGRIPLSHIRLLPPDYKIQCAEPS 2249

  Fly  1797 PPVTVPQAAAVPRKARIGKSMAREMVYAAQQQLLPEKQLKQPKEAAAKLEAEPEM-PFVLKAEIK 1860
            |.:.||.|....||:...:..|:|......:::..:.:.:..|:...::..|..: ...:..|..
 Frog  2250 PALLVPSAKPRSRKSSKEQVEAKEAGSTGCEEVSVKSKSRGRKQNLKQITGETIINEDTVDKESL 2314

  Fly  1861 AETKIKIEHDGEAQAS----THISQLPDLKPTIKTEPEQELEQEAASVPSVAKTEPQPEVEVERE 1921
            ..|||.:|....:|.|    |.|.|:|                                      
 Frog  2315 LSTKICLEKHESSQTSIKLGTKILQIP-------------------------------------- 2341

  Fly  1922 QQEPPVDEEQQPTPGGSKQRFNLLALSSGNKKTKTNNSYKSLIKQAEPKSYLCPGRRFIR-RHGR 1985
                   ||..||.|..|.|        ..::.||       .|....|..:..||...: .:|.
 Frog  2342 -------EENSPTHGTPKIR--------KPEQMKT-------AKLCNAKQTIYTGRTLGKVENGN 2384

  Fly  1986 APAKYVKRRQMILTQRQQQRMRLQRREQQ--------QQRRQQREAAAEVVAGAVVTPSLAGNPI 2042
            .|....    :.|..:.:...::::.|:|        :|.:.:.:...::....|::|       
 Frog  2385 PPCDLT----VNLFDQLEDTKKIRKLEEQRDFVSLSTKQGKAENDFFVKLDHEGVMSP------- 2438

  Fly  2043 EQAGSEVSIVKDQAPNSSATPSASPKRARPRKQEIAALHLLEGLDTTLSRGYFSDPELNHSSRKQ 2107
                                   ..|:|:      .|:..||....|:              :|.
 Frog  2439 -----------------------KTKKAK------EAMMWLEDASVTM--------------KKT 2460

  Fly  2108 APTAVGGLYA-----ASSPLTTATDHRGKQTTA---EKRSKSETKKPPSGESSESGLPCKKPRKE 2164
            ....:|..||     :...|:.:..|..|.|||   |..|.|..|.....:..:..|   .||:|
 Frog  2461 RKCIMGVSYAPVKHESKQKLSRSKPHLAKHTTACDSEALSSSLDKYKKKSDQKQGLL---DPREE 2522

  Fly  2165 PAG-----KVKGKGKKTTAGAAATTIASTAETQTEAVNAITASNQETNNNEYQTADLQAQKFREC 2224
            ..|     :.:|:..|......|....|::.:|:.....::.|:..|:::...::.      ..|
 Frog  2523 SDGSSSNSESEGEEDKENKQKQAQGDESSSSSQSSTSVCLSKSSSGTSSSSSSSSS------SSC 2581

  Fly  2225 PAVTDAKVAGTATSTSTASQQQNQQHSDEQHQFLVPSQPATASATAALAATPPPSRQG--QATHT 2287
            .: :.|..:.:::|:||..:..:....||..:  :.|.|.....:....:..|..:.|  |..:.
 Frog  2582 SS-SSASSSSSSSSSSTTDEDSSSTSEDETQE--LTSNPTNLQISLQKGSIKPAIKPGTPQIQNQ 2643

  Fly  2288 KRTRSRCKFGNRKRQRHRPGGVSYELDVTQPPATKANVVPKWNNG------------WMWAGKAF 2340
            ::.:...|.|::...:.|.|   ..|..|:..| |...:|...|.            |.|.||..
 Frog  2644 RQKKQEQKKGSKNTPKKREG---IHLPTTKELA-KRQRLPSVENRPKIAAFLPARQLWKWFGKPT 2704

  Fly  2341 QGAVFLNSDDPLVLRTCYPAMRHVEG-DIIRIRDC-VLLKANEDNELPYVAKVAHLWQNPEDGEM 2403
            |..........|.    |.|:  |.| :||||.|| |.|.|...| |||:.::..:|:: ....|
 Frog  2705 QRRGMKGKARKLF----YKAI--VRGKEIIRIGDCAVFLSAGRPN-LPYIGRIQSMWES-WGNNM 2761

  Fly  2404 MMSLLWYYRPEHTDQGRQRNDCPD-------------------------EVYASRHRDHNSVACV 2443
            ::.:.|:|.||.|:.|::.||...                         .:|.|.|.|.|.|..|
 Frog  2762 VVRVKWFYHPEETNPGKKLNDTKSWDQKSGKSSLSGLQMSSLRKDFMERALYQSSHVDENDVQTV 2826

  Fly  2444 EDKCYVLTFSEYCRYRRRLRAAE-EDVEDV-----SIVPRRPSIATAPGFPV 2489
            ..||.|:...:   |.:.|:..: :|.||:     :..|....|....|.||
 Frog  2827 SHKCLVVALEQ---YEQMLKTKKYQDSEDLYYLAGTYEPTTGMIFNTDGVPV 2875

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 44/158 (28%)
tnrc18XP_017952853.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.