DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and bahcc1

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:XP_004916413.1 Gene:bahcc1 XenbaseID:XB-GENE-6458577 Length:2557 Species:Xenopus tropicalis

Alignment Length:2821 Identity:518/2822 (18%)
Similarity:859/2822 (30%) Gaps:947/2822 (34%)


  Fly   276 TSAATSAPSSASTS-KHTSTKNP---GKKS---AHSEQMPKKELSKLAKMGKPKK-----EANLV 328
            ::||::.|:.||.| :.|:.:.|   |...   :||.:...:..:.||....|..     .:|::
 Frog    75 SAAASAHPAGASNSPQETTYRGPHGAGTSQIWFSHSHEGYPRFSASLASTFLPMSHLDHGNSNVL 139

  Fly   329 KSTARLPDSNTESVQMELEEIVSTPTVTPTPSATPTATPTPTATPTLTPT----PTATRTRTPTP 389
            ....|..:|..::..:.     :.|                 |.|||...    |:..|      
 Frog   140 YGQHRFYESQKDNFYLR-----NLP-----------------AQPTLLSANHNFPSIAR------ 176

  Fly   390 TLTPTPTPTSTPSSTAIAAGQPAPPPPPPGGAPKQRPKVKYTKTSAGSKGRMQQALNQKAPAASW 454
                                  |.|..|.|...:.|                :.:..||.....:
 Frog   177 ----------------------AAPGHPIGSCSRDR----------------ENSHLQKKDTERY 203

  Fly   455 SGAKDIY-------DFKSGS-EDE--EPIKMVLP-SL-----KELREFSDEDNKPLKLFERQAEK 503
            .|:.|:.       |.|... |||  |..|:||| ||     ::|.:....||: .|........
 Frog   204 LGSTDLNKEKMIKGDLKERHIEDEGKERQKVVLPMSLDGHCKEDLHQRGSCDNR-TKHLNSCLMT 267

  Fly   504 TKVQVQDEEEQPL-------VKKEEKPPSEKEVKVKSKEKEKEKEKDVDPLSNAQQSEPAAKHTT 561
            :||...|..:..|       |...:...|.....:...:|...:.....|.|...:......|:.
 Frog   268 SKVLNGDPGKAGLSSCTMGTVMPRQGSQSRCAKDIMRSDKTYPQHDPQQPYSECLERRQMLHHSV 332

  Fly   562 STS------------TTSTTSITSVKKQAKRKIATPMPSSAGRKKKTVGK-------GKAAAAKE 607
            |.:            .|||.|...::..:...:...:...|||..| :|:       |.......
 Frog   333 SYTVPSSLPSIPAPLNTSTGSFPCLQLHSNPDVVCSLQEKAGRDLK-MGRPTFVPSVGHFTDKSR 396

  Fly   608 P---PPSGSSAESSSSEDERKLSAYSGPKRHRMASLNALAKVQCLYEN---ESRTAHELGLSKAT 666
            |   .|.....:....:|          |.|.|   |....:|..|.|   ..:|.:::......
 Frog   397 PFQVTPESCHVDRGEGKD----------KGHEM---NTDIHLQGSYSNTFSHLKTENKVDRRLEW 448

  Fly   667 QQPP--RIRTLD-------------GSDDDNHKDSPRHGDTDRDKGSVSPPHTSA--APPAAPIA 714
            ||.|  ||:.|:             |.:...:.:.|:..|..|      |.|..|  ..|:....
 Frog   449 QQNPAARIKNLEFLNSGGSEHAMQRGMEKGGYFEMPQSQDCPR------PNHQDAHCVKPSQSCC 507

  Fly   715 ----PPKEAEPRRELRYVPGGRGVGKHWEFDSDSETEELQLQQTLPPVKKKKLPKKAPPKKVASS 775
                |||:.:...                   ..:...::.||..|...::           ..|
 Frog   508 TLDRPPKDPQTHH-------------------SQKIARIRHQQHRPTEMEQ-----------TGS 542

  Fly   776 ETDAKRKKKSVQVEES----------DDEEAKEKEKEKEKPKPPKQLPKKRKTAFT------EEL 824
            ..|.||  |::::...          :|......|:.|.....|.....::.|..|      :|:
 Frog   543 GQDGKR--KTIELNSLGYNGPHLPPWNDPSISISEERKNSYLDPFSTSLQQATLMTPGPSLSQEM 605

  Fly   825 IGDYKGILARKRMASLNASAIVAATYEVERHLDKNLASDCSSFESYDELDTMPTTTSKVTSAAAI 889
            .|....:.|.|.:...:..|::.........|. |:.:.||..|.............::..|.:.
 Frog   606 QGPTDEVSAMKNLLKYSNQALIVGQRAPFVGLG-NMKASCSQQEMKFHSSKCQPEQERMDCARSR 669

  Fly   890 KTEVIHIKKEPKESKESLRER-ERERESERRRERDNELKDSTVGKMSSHSIIEESNDSKYSKETK 953
            :.|:.|...|.::....:... .|::::..|       :|::.|..||    .:|.::...|.|:
 Frog   670 ENEISHGDGEVRQPPVGIAVAVARQKDTGGR-------QDASFGAGSS----RQSRNNMGPKGTQ 723

  Fly   954 ETNTDTT--ITTTGYRDSAASTKDAKD-----CSR--PTSSSVVIVQDTDVTITGVYVNASNGAA 1009
            ..||..:  :.|...|.......||.:     |..  ..|...:::|::...:....::.|:|..
 Frog   724 NRNTSRSQNLATGSGRSMHVIDLDADEERNRLCDERLGISGRDILMQESKDLVEFARIHPSSGCP 788

  Fly  1010 QEAYCKMQYRVQSSVTEERV-LRPGS----VEP---PKSYTPL------------SALSSMLPPG 1054
            .:....:.....||:...:: ..|.|    ..|   |::.:|.            .||...||||
 Frog   789 GDLTPHLMIAGGSSLQASQLGGDPASHSHPTHPHWLPRTRSPSIWMGGHSYSISHPALHQNLPPG 853

  Fly  1055 ASSGLSEAHSSPPLPVHAAPTGPHVLLPGEHLSAGMYHAPDLGLHT-EHALPDHHGPP---PPSY 1115
            ..:.:..| ..|..|:...|....|:||           ||...|| .|.|.|.....   ||.|
 Frog   854 FPTSMPSA-MQPVFPLSQEPPAQLVILP-----------PDPTPHTAPHPLADVMDQASLWPPMY 906

  Fly  1116 AAAAAAAAAAAAYHAHQLAPGGGGVLHMHH---------------QHQYAAHAAHA--------H 1157
                               ||.|...|:.|               |..||.....|        .
 Frog   907 -------------------PGRGPASHLQHPGQLPVYSRSQFLRQQELYALQQQRAAALELQRQS 952

  Fly  1158 HYQQAAEYHGGPPPPPHHYG-------------------GPPPQGHYGPPPGAPVPV-PVAVPNT 1202
            |.|:..|.|     .|.|..                   |..|.....|||.||..: |......
 Frog   953 HLQRKPEDH-----LPEHEDTTEKTIKSHSKTDSLNTSKGQTPPALLLPPPSAPSKLSPCCHSPA 1012

  Fly  1203 VTVPPERCDVGSPPPSYRASAYPPPSSVGMPPPTLGGGSSAFCAPSPLHHHQHQHQQPGPGVGPP 1267
            :..|..:|....|.......|.|..|||.:|       ||...:|.|:.:.:.:..:...|.|.|
 Frog  1013 IRPPSSKCPTPRPLVPCTLPACPDASSVLVP-------SSPAVSPVPVQNAKGKEGEERRGEGQP 1070

  Fly  1268 HHD---------PSGYYQP------AGPLISPHVIAAPPPPAQVKKLQEE--------------- 1302
            ..|         |.||..|      ..|  |||.:.: ..||..:.:|:.               
 Frog  1071 PRDYPKSLEPDLPPGYTYPDVVQSYTSP--SPHHVHS-ADPADTESMQKASVAAEPEQSRTFTPT 1132

  Fly  1303 ----DGPVSAAGSPTQLQQ---------------------QQAAAEAAAAAADQAAAQS-QSQSQ 1341
                |.|||  |...:|.|                     |:.....||.|||:...:: :::..
 Frog  1133 KKPCDTPVS--GDSLELSQELSNLGETDLNEICVQVPQGSQELECGEAAVAADKCTDKAEETRDN 1195

  Fly  1342 GQSHGHAHSHAHNPQQAQHPPQ------------PQPYPAGAVAAAAAAAAAHQGVPYS------ 1388
            .:.....|......::.:....            ....||.::.........::.||.|      
 Frog  1196 VEEVQPVHEEVDREKELEEDGDLIDTSSEQLLNISNGSPAASLTTEETNIETNEEVPASSVDIGG 1260

  Fly  1389 ------------------RSMHAAQMHYSTGYP-------------------------PNYYAPY 1410
                              .|..|..:||.:.|.                         ||..:|:
 Frog  1261 QESRDPEETEDKVLAISQTSSPAPSIHYDSLYTLDTLIEASISMGELSSLLDEGNICCPNTLSPH 1325

  Fly  1411 P----------GEVMCYSPPTYPPYFSS-----------KVYQPSHPAHPAAH-------PQGPP 1447
            |          .|:...:....|.|.:.           :|:.....|...|.       |.|.|
 Frog  1326 PSSGIHGIALLSELADLALQEQPKYTTKTNEDESVVSDLQVFATIASAWSLAEAAILEDVPSGYP 1390

  Fly  1448 PPGAY-----------------------------------------------RRYPYYQH--AGP 1463
            .|..:                                               |||...|.  ...
 Frog  1391 IPYCHNVAPRVRLSRRTYTWTPKTKMVCPLKAAIDHLDTQEVDMRMKLAEIQRRYKEKQRELVKL 1455

  Fly  1464 PPPHELYEQQPPPPPVSSGSVSGPAQQQPPTSSPASVGAAGAGTA-----------------GAP 1511
            ...|:..:::....||..|  .|..:::|...:|:|..:..:..|                 |.|
 Frog  1456 QRRHDHEKEESSRSPVRRG--PGRPRKRPHCRAPSSHRSNESKRAKSLNKSLSLLCTELRADGEP 1518

  Fly  1512 SGSQLVPAHQQQHQQQHLEHYPGPPSYYAGYSPGGGASAGQCYTRGLQGPYMEYPPQCPCPMPQS 1576
            :..::          :.||                     :||:.      .|:||..   :...
 Frog  1519 TKKKI----------KLLE---------------------ECYSD------REHPPSA---VNMH 1543

  Fly  1577 CPKNVHTGPHIGSNIISNIDQSSSCSSSMLLSATSNSNIGGGSSSSSSSSSSTTLPACSSATTTT 1641
            |.|.|.....:.|.:...:.:..|.:.....||..|.:      :..:|.....||....|    
 Frog  1544 CKKTVSPQNKLSSKLAQKVSKLKSKALGSAGSAFCNKD------ALPASKIQKKLPHHKGA---- 1598

  Fly  1642 TASALTTSRG----PVKNVTPNNSNSSGHTSTNSCRSSNNSNNSSNSSCQTIEMTSWATAATNTT 1702
               .|...:|    ..:.:.|.||...        ....:.:|..:|..:  |.......||:..
 Frog  1599 ---GLMLKQGLERKGQERLQPANSTEG--------PEEGDVDNEEDSDSE--EEQGLPVVATHDA 1650

  Fly  1703 S----TTATTATTGTQCQMLVKTELKGENPQVTKMQYEAHVMPPPTPPESYCA--SDEKLLDDQE 1761
            |    ||.:.:..|.....:||.|..    |..|.:.|...:     ..|||:  |.|..:..::
 Frog  1651 SLALHTTVSPSLVGPSPSSVVKMEAN----QKAKKKIERQGL-----LGSYCSITSPENEVKIRK 1706

  Fly  1762 QEAELELRLRLGLGLEK---SHGG------QQHIEAYDLTCSTPPPVTVPQAAAVPRKARIGKSM 1817
            :.|:|:.::.....|:|   ||..      :|.|.:..|| .||........|...:|.:..|.:
 Frog  1707 RSAKLDAQVLPMKPLKKKSLSHTSKAKGALRQSIPSGTLT-HTPSKSLFSSPALSLKKDKKSKDL 1770

  Fly  1818 ARE-------MVYAAQQQLLPEKQLKQPKE---AAAKL----EAEPEMPFVLKAEIKAETKIKIE 1868
            .|:       :.....:.||.:.::|..:|   |.::|    ..|.:..|...:......:....
 Frog  1771 QRKNGVLSLSLTSRGPKSLLKQGRVKSKQERGRAVSRLLQSFAVEDDFQFDDNSSFSEGEEDVSP 1835

  Fly  1869 HDGEAQASTHISQLP--DLKPTIKT-EPEQELEQEAASVPSVAKTEPQPE------VEVER---- 1920
            ..|:::..||:..|.  ||:..:|. .|:::....|||:.|:     ||.      :|.||    
 Frog  1836 AGGKSKDQTHVCSLTKGDLREGLKVLIPKEDNLMYAASIRSL-----QPPDIYSVVIEGERGNRP 1895

  Fly  1921 -----EQ--QEPPVDEEQQPT---------------------PG--------------------- 1936
                 ||  ||..||...|..                     ||                     
 Frog  1896 RIYSQEQLLQEAVVDIRPQSIRCLPHGTRVCAYWSQKSRCLYPGNVVRGSSSDESESDSVTVAFD 1960

  Fly  1937 -GSKQRFNL-------------------------------LALSSGNKKTKTNNSYKSLIKQAEP 1969
             |.:.|..|                               |.||:.:::.|..:|..|  ...||
 Frog  1961 DGDRGRIMLNNIRLLPPDFTIQCKLFPAYDKAQSTEPSPALLLSAESRRAKRVSSNTS--TSTEP 2023

  Fly  1970 KSYLCPGRRFIRRHGRAPAKYVKRRQM-------------------------ILTQRQQQRMR-- 2007
            ...|.|..|.|....:..:|.|..::.                         :|....|.:.:  
 Frog  2024 AQNLNPDSREIEETPKNISKKVSNKEKTDVFNSGAKTQLPVTNFLGRSTNVGLLNWTSQGKRKGG 2088

  Fly  2008 ------LQRREQQ------QQRRQQREAAAEVVAGAVVTPSLAGNPIEQAGSEVSIVKDQAP--- 2057
                  |....||      |:.|:|              |.:.||.. .|||..|:.....|   
 Frog  2089 ARTGAGLHETFQQPGCGKKQKSREQ--------------PHVFGNGF-GAGSFSSLANSYLPFGG 2138

  Fly  2058 --NSSATPSASPKRARPRKQEIAALHLLEGLDTTLSRGYFSDPELNHSSRKQAPTAVGGLYAASS 2120
              |:..|.|..|.|.:                    :|..|:.|......|:         .|.:
 Frog  2139 SSNTGLTLSQKPVRTK--------------------KGDRSEEEDKGKGCKR---------KAGN 2174

  Fly  2121 PLTTATDHRGKQTTAEKRSKSET-------KKPPSGESSESGL----PCKKPRKE--PAGKVKGK 2172
            ......||.|..:...|..|:..       .:.....||::||    .||.|..|  |.....||
 Frog  2175 EFLVKLDHEGVMSPKTKNGKALLLCDRDFGLRIGQSYSSQTGLGKDKKCKPPLHEHLPMSLALGK 2239

  Fly  2173 GKKTTAGAAATTIASTAETQTEAVNAITASNQETNNNEYQTADLQAQ---KFRECPAVTDAKVAG 2234
                .:|.:...:...::..:      :.|:|:...||   .||.|:   :|.....|:.:. :|
 Frog  2240 ----YSGQSEYGLNCDSDCPS------SYSDQDEEENE---GDLPARVPSQFLAGLTVSSSS-SG 2290

  Fly  2235 TATSTSTAS----------QQQNQQHSDEQHQFLVPSQPATASATAALAATPPPSRQGQATHTKR 2289
            :::|:|:.|          .:.:.:.|||....|: .||.......||.|..|  ..|.::    
 Frog  2291 SSSSSSSGSLSSSSICSTDNEDSSESSDEGDSSLL-LQPCLTHPVPALLAQHP--EDGGSS---- 2348

  Fly  2290 TRSRCKF--GNRKRQRHRPGGVSYELDVTQPPATKANVVPKWNNG------------WMWAGKAF 2340
              ||..|  |.:.:||.:  |.|.....|:.||.|...:|...|.            |.|:|:..
 Frog  2349 --SRGCFVPGQKAKQRRK--GTSSNFSKTKEPAPKQQRLPSVENRPKISAFLPARQLWKWSGEPT 2409

  Fly  2341 QGAVFLNSDDPLVLRTCYPAMRHVEG-DIIRIRDC-VLLKANEDNELPYVAKVAHLWQNPEDGEM 2403
            |..........|.    |.|:  |.| :.:.:.|| |.|.|...| |||:.::..:|:: ..|.|
 Frog  2410 QRRGMKGKARKLF----YKAI--VRGKETLHVGDCAVFLSAGRPN-LPYIGRIESMWES-WGGNM 2466

  Fly  2404 MMSLLWYYRPEHTDQGRQRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEYCRYRRRLRAAEED 2468
            ::.:.|:|.||.|..|::.:|..:.:|.|.|.|.|.|..:..||.|::..:|.:.....|  .:|
 Frog  2467 VVKVKWFYHPEETKLGKRHSDGKNALYQSSHEDENDVQTISHKCQVVSRQQYDKLSHNKR--YQD 2529

  Fly  2469 VEDVSIV-----PRRPSIATAPGFPV 2489
            .:::..:     |....:.||.|.||
 Frog  2530 RQNLYYLAGTYDPGTGRLVTAEGVPV 2555

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 38/132 (29%)
bahcc1XP_004916413.1 BAH_BAHCC1 2430..2549 CDD:240065 32/123 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.