DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hers and LOC100331694

Sequence 1:NP_001245771.1 Gene:Hers FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:XP_005173894.1 Gene:LOC100331694 ID: Length:841 Species:Danio rerio

Alignment Length:938 Identity:211/939 (22%)
Similarity:321/939 (34%) Gaps:306/939 (33%)


  Fly  1734 QYEAHVMPPP--------------------TPPESYCASDEKLLDDQEQEAELELRLRLGLGLEK 1778
            ||::..:|.|                    ||.:|.|........|::|::..:.|..|     :
Zfish    53 QYKSQRLPTPPMNSVNERKRKLYPLRGRGGTPEDSLCCHVLLTRLDEQQDSTNKTREPL-----Q 112

  Fly  1779 SHGGQQHIEAY-DLTCSTPPPVTVPQAAAVPRKARIGKSMAREMVYAAQQQLLPEKQLKQPKEAA 1842
            |.|.:...... .|.......:.:.:.|...|....|..|.:......:.|   :|..::|:|:.
Zfish   113 SSGQEPRTRRLASLNAEALNSLLLEKPAGAMRTRAEGACMKKSWRRPEESQ---KKSWRRPEESQ 174

  Fly  1843 AKLEAEPEMPFVLKAEIKAETKIKIEHDGEAQASTHISQLPDLKPTIKTEPEQELEQEAASVPSV 1907
            .|....||                     |:|..|........|.|.:...|.:.:.......|.
Zfish   175 KKTWRRPE---------------------ESQKKTWRRPEESQKKTWRRPEESQKKSWKRPEESQ 218

  Fly  1908 AKTEPQPEVEVEREQQEPPVDEEQQPTPGGSKQRFNLLALSSGNKKT--KTNNSYKSLIKQAEPK 1970
            .||..:||...::..:.|   ||.|                   |||  :...|.|...::.|..
Zfish   219 KKTWRRPEESQKKTWRRP---EESQ-------------------KKTWRRPEESQKKSWRRPEES 261

  Fly  1971 SYLCPGRRFIRRHGRAPAKYVKRRQMILTQRQQQRMRLQRREQQQQRRQQREAAAEVVAGAVVTP 2035
            .     ::..||...:..|..:|.:      :.|:...:|.|:.|::..:|              
Zfish   262 Q-----KKTWRRPEESQKKTWRRPE------ESQKKSWKRPEESQKKTWRR-------------- 301

  Fly  2036 SLAGNPIEQAGSEVSIVKDQAPNSSATPSASPKRAR-------PRKQEIAALHLLEGLDTTLSRG 2093
                 |.|.........::....|...|.||.||.:       ||:        |.||:|.....
Zfish   302 -----PEESQKKSWRKPEESQRKSWRRPEASQKRMKMDLCSPAPRR--------LAGLNTAALLN 353

  Fly  2094 YFSDPELNHSSRKQAPTAVGGLYAASSPLTTATDHRGKQTTAEKRSKSETKKPPSGESSESGL-- 2156
             .|.|..:|.|    ..|||                            ...||.:|...::..  
Zfish   354 -ISSPSAHHRS----VCAVG----------------------------NDGKPTAGNDGKAIAWR 385

  Fly  2157 ---PCKKPRKEPAGKVKGKGKKTTAGAAATTIASTAETQTEAVNAITASNQETNNNEYQTADLQA 2218
               .|:.|..:.:..|..|||..   .::.|.......|...:...          ..:|||::.
Zfish   386 AIKLCRHPSHQESICVVCKGKSL---ESSPTFQEDPGYQPHGILGY----------PIKTADMRT 437

  Fly  2219 QKFRE----------CPAVTDAKVAGTATSTSTASQQQNQQHSDEQ------HQFLVPSQPATAS 2267
            ...:|          ||||...:.   .........||..:.|:||      |:.::|:.|...|
Zfish   438 VSVKEEHAEPVQCCCCPAVGAVEF---CHHLPMFLHQQAYRESEEQPVASIRHECVLPAPPLALS 499

  Fly  2268 ATAALA--------ATPPP---SRQGQATHT---------------------------------- 2287
            .....|        :.|.|   :|....|||                                  
Zfish   500 HPCLCAEPCYYIHISHPGPTAAARPLPCTHTHCCPRGVSKLLPATGLPHPHPAYCCLCPAARLPY 564

  Fly  2288 -----KRTRSRCKFG----------------------------------------NRKRQRHRP- 2306
                 ..|...|.|.                                        |.|...||| 
Zfish   565 TYLTLPETACSCSFSCSTSRHSSRTEAPPDAPALLLSPGCPSMPLVNRSARECPQNPKPSGHRPL 629

  Fly  2307 ---------GGVSYELDVTQPPATKANVVPKWNNGWMWAGKAFQGAVFLNSDDPLVLRTCYPAMR 2362
                     |||.......:|.          .|||...|.:.|..:.:..|:..|||.||.:::
Zfish   630 RTTRRLRPAGGVLRRRSTRRPD----------TNGWRPVGASTQRELLMAGDEQTVLRQCYDSVQ 684

  Fly  2363 HVEGDIIRIRDCVLLKANEDNE-LPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGRQRN-DC 2425
            . :|::||:||.||||:....: ||||||::.||:.|..||:||||.||||||||..||..: .|
Zfish   685 R-DGELIRVRDTVLLKSGPRRKTLPYVAKISALWEEPRTGELMMSLFWYYRPEHTQGGRDPSMHC 748

  Fly  2426 PDEVYASRHRDHNSVACVEDKCYVLTFSEYCRYRRRLRAAEEDV-EDVSIVPRRPSIATAPGFPV 2489
            ..|::||||:|.|||||:|::||||..::|||:...:|...|.| |.|.:|| |.|..:.|..  
Zfish   749 EKEIFASRHQDENSVACIEERCYVLPLAQYCRFCALVRRGVEGVCERVPLVP-RCSAGSVPNH-- 810

  Fly  2490 RTVPEHTNPELVMFCRRAYEFRTRRLLK 2517
            |::|...:|:||..||..|::|..|:||
Zfish   811 RSLPTGVDPQLVYLCRHVYDYRYGRILK 838

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 76/156 (49%)
LOC100331694XP_005173894.1 DUF4887 161..325 CDD:292845 41/240 (17%)
BAH 687..792 CDD:295389 56/105 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005597
OrthoInspector 1 1.000 T597843
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46576
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.