DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB2 and DnaJ-H

DIOPT Version :8

Sequence 1:NP_006727.2 Gene:DNAJB2 / 3300 HGNCID:5228 Length:324 Species:Homo sapiens
Sequence 2:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster

Alignment Length:132 Identity:50/133 (38%)
Similarity:68/133 (51%) Gaps:35/133 (26%)


Human     5 YEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYG 69
            |::|.|...|:.::|||.||:.|.::|||||||    |..||||::.|||||||..||.||||||
  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD----AGDKFKEISFAYEVLSDPEKRRIYDRYG 67

Human    70 REGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDLGPFSELQNRG-SRH 133
            .:||          :.|:.|      |....|.|.::|              ||..:.:.| .|.
  Fly    68 LKGL----------QEGAEG------FSDASEFFAQWF--------------PFDRVSSEGRGRR 102

Human   134 SG 135
            :|
  Fly   103 NG 104

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAJB2NP_006727.2 DnaJ 3..>110 CDD:223560 45/105 (43%)
CAAX motif. {ECO:0000269|PubMed:12754272} 321..324
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 50/133 (38%)
DnaJ 5..64 CDD:278647 33/61 (54%)
DnaJ_C 106..329 CDD:199909
DnaJ_zf 134..197 CDD:199908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000353
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.