DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB2 and CG40178

DIOPT Version :8

Sequence 1:NP_006727.2 Gene:DNAJB2 / 3300 HGNCID:5228 Length:324 Species:Homo sapiens
Sequence 2:NP_001015187.2 Gene:CG40178 / 3354941 FlyBaseID:FBgn0058178 Length:780 Species:Drosophila melanogaster

Alignment Length:65 Identity:26/66 (39%)
Similarity:43/66 (65%) Gaps:2/66 (3%)


Human     5 YEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYG 69
            |.||.:.:.|:..:|::||:..|.:|||||  ...::..:||.::..|||:|:|..:|.|:||||
  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDK--VKNDYGAEKFIQIKLAYEILADLDRRRIFDRYG 94

Human    70  69
              Fly    95  94

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAJB2NP_006727.2 DnaJ 3..>110 CDD:223560 26/66 (39%)
CAAX motif. {ECO:0000269|PubMed:12754272} 321..324
CG40178NP_001015187.2 DnaJ 30..>94 CDD:223560 25/64 (39%)
DnaJ 30..91 CDD:278647 22/61 (36%)
TRX_DnaJ 134..244 CDD:239261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.