DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB2 and CG5001

DIOPT Version :8

Sequence 1:NP_006727.2 Gene:DNAJB2 / 3300 HGNCID:5228 Length:324 Species:Homo sapiens
Sequence 2:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster

Alignment Length:289 Identity:99/290 (34%)
Similarity:129/290 (44%) Gaps:94/290 (32%)


Human     4 YYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRY 68
            ||:||.:|::|:.|:||||||:.||::|||||  ....||.|||||||||||||||.|||:||:|
  Fly     5 YYKILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67

Human    69 GREGLTGTGTGPSRAEAGSGGP---GFTFTFR-SPEEVFREFFGSGDPFAELFD----------- 118
            |.:||...||       .:|||   .||:.|. .|...|.:|||:.:|||..||           
  Fly    68 GEDGLKSGGT-------RNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVF 125

Human   119 DL--------GPFSELQNRGSRH---SGPFFTFSSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTT 172
            ||        .||..:   ||||   ||    |..||..|                  |.:..|.
  Fly   126 DLDTEPDFFSSPFGGI---GSRHGLGSG----FRPSFRSH------------------SFNVHTP 165

Human   173 FVQGRRITTRRIMENGQERVEVEEDGQLKSVTINGVPDDLALGLELSRREQQPSVTSR------- 230
            |.:.::           :...||.|   ..||:..:.......:::|||..|...:||       
  Fly   166 FKKEQK-----------QDPPVEHD---LYVTLEEIYHGCVKKMKISRRIVQADGSSRKEEKFLA 216

Human   231 -------SGGTQV------QQTPASCPLD 246
                   ..||:|      .|.|...|.|
  Fly   217 ISIKPGWKSGTKVTFQKEGDQAPGKIPAD 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAJB2NP_006727.2 DnaJ 3..>110 CDD:223560 59/110 (54%)
CAAX motif. {ECO:0000269|PubMed:12754272} 321..324
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 99/290 (34%)
DnaJ 4..65 CDD:278647 41/62 (66%)
DnaJ_C 174..338 CDD:199909 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117004509
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.