DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB2 and CG2887

DIOPT Version :8

Sequence 1:NP_006727.2 Gene:DNAJB2 / 3300 HGNCID:5228 Length:324 Species:Homo sapiens
Sequence 2:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster

Alignment Length:277 Identity:75/278 (27%)
Similarity:114/278 (41%) Gaps:77/278 (28%)


Human     4 YYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRY 68
            ||:||.:.|:|:..:|:|||.::||::|||||...:  ||:.||:||:||||||||.||..||..
  Fly     5 YYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQ--AEEIFKQVAKAYEVLSDKKKRGSYDSR 67

Human    69 GREGL------TGTGTGPSRA--------EAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDD 119
            ..:|.      .|:|.|...|        .:||||........:|...|..||.:.:.::..|:|
  Fly    68 NDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGRQNNPRANFGRFFDNSESYSTFFED 132

Human   120 LGPFSELQNRGSRHSGPFFTFSSSFPGHSDF-SSSSFSFSPGAGAFRSVSTSTTFVQGRRITTRR 183
            :                          .:|| |........||||                 .:|
  Fly   133 I--------------------------ENDFDSDDDVLLGGGAGA-----------------PKR 154

Human   184 IMENGQERVEVEEDGQLKSVTINGVPDDLALGLELSRREQQPSVTSRSGGTQVQ-------QTPA 241
            ..|....:..:|.       .|....:|:|.|  .:||.:....:.|:|...||       :.|.
  Fly   155 RCEQQSPQSSIEH-------VIYVALEDIANG--CNRRMKISRASGRNGVDGVQYDRILTVKIPP 210

Human   242 SCPLDSDLS-EDEDLQL 257
            .|...:.:. .:|.:||
  Fly   211 GCKAGTKICFPNEGIQL 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAJB2NP_006727.2 DnaJ 3..>110 CDD:223560 48/120 (40%)
CAAX motif. {ECO:0000269|PubMed:12754272} 321..324
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 75/278 (27%)
DnaJ 4..65 CDD:278647 34/62 (55%)
DnaJ_C 163..326 CDD:199909 16/75 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117004513
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.