DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pmp70 and abcd4

Sequence 1:NP_001259732.1 Gene:Pmp70 FlyBaseID:FBgn0031069 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001070185.2 Gene:abcd4 ZFINID:ZDB-GENE-050517-30 Length:604 Species:Danio rerio

Alignment Length:620 Identity:186/621 (30%)
Similarity:316/621 (51%) Gaps:62/621 (10%)


  Fly    67 FFKQLRQLLPILIPGFWSVETGLLFLVAAALIGRSVSDIWMIQNATVVES----TIIHMNRTKFK 127
            |.::...:|.||.|. ||.:...:|:   .|:|.::|...:|....::.|    .:...:..|||
Zfish    18 FLQRFYSILKILFPS-WSNQNVRMFM---TLLGVTLSVQLVIYQVGLIPSQFYRVLSERSYGKFK 78

  Fly   128 TALLKYLTALPAISVVTNVLKWSLGELKLRFRTNLTHHLYSQYLNGYTYYKMSNLDNRIANADQL 192
            ..::..:..:...|.:.::.::....|.:|:|..||..|:..|..|..||.::.|...|.|.||.
Zfish    79 DLVVFAVVLILINSTLKSLDQYICSLLYVRWRKTLTEDLHHLYFKGRVYYTLNILCKDIDNPDQR 143

  Fly   193 LTTDIDKFCESATDLYSNISKPVLDIFIYVYRLTVNLGGKTPSILMLYLLFAGVFLTR-LRRPTG 256
            ::.|:::.|:..:.:.|.:......:..|.|: ..|..|....:.:......|..:.: |..|..
Zfish   144 ISQDVERLCKQMSTMASRLLITPFTVTYYTYQ-CFNSAGWIGFVSIFSYFVVGTIINKILIGPIV 207

  Fly   257 RLTVEEQKLEGEFRYVNSRLITNSEEVAFYQ-GNVR-----EKLTLLASYSKLRSHLRKFLEFRV 315
            .:.||::||||:||:.:.::..|:|..|||: .||.     .||.:|.|..  ||.:.|.|...:
Zfish   208 SMLVEQEKLEGDFRFKHMQIRVNAESAAFYRASNVEHMRTDRKLQMLLSTQ--RSLMNKELWLYL 270

  Fly   316 SMGIIDNIIGKYFASIVGFYAVSIPFFSENHP-LLSGENSGQRLQAYYTYGRML-VKLAEAIGRL 378
            .:...|     |..||:.:..::||.|:.|:. |..||     |.|..:....: :.|.....:|
Zfish   271 GVNTFD-----YMGSILSYIVIAIPIFAGNYDHLTPGE-----LSALISKNAFVCIYLINCFTQL 325

  Fly   379 VLAGREMSRLAGFTARMTELIKVLSDLNK---GTYERTMV-----NGNNLAQNAVGSASSNFGPN 435
            :.....:|.:||:|.|:.||.:.::|:.|   ..|:...|     |.:...|:.  .|.:.|..:
Zfish   326 IDLSTTVSDVAGYTHRIGELQEAMADIAKKQRDEYQYDPVSKAESNSDRELQSV--PADTAFVLD 388

  Fly   436 KGIMCFEDNIIRFEKVPLVTPNGDVLLQELSFEVKSGTNVLVCGPNGCGKSSLFRILGELWPTWG 500
            :  :|:        |.||   :.::|:::|:..:..||::||.|..|.||:||.|:|..||....
Zfish   389 R--LCY--------KSPL---SEELLVKDLTLSISQGTHLLVVGNTGTGKTSLLRVLNSLWEPCR 440

  Fly   501 GKVTKPS----RGKLFYVPQRPYMTLGTLRDQIIYPHTRDDMRRLGH-SDEDLMHYLDIVQLTYL 560
            |.|...:    || |.::||:.|:|.|||||||||| .:|.....|. .||.::.||::|.|:.|
Zfish   441 GSVQMTTCFGPRG-LMFLPQKAYLTDGTLRDQIIYP-LKDIYPSSGSIDDERILKYLELVGLSNL 503

  Fly   561 EQRENGLDS--IEDWIDVLSGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGKMYSYCREVG 623
            ..|..|||:  ..:|.||||.||.||:..|||.|.:|:||:|||.|||::.:.||::|:.|::.|
Zfish   504 LTRIGGLDTEVTWNWYDVLSPGEMQRLCFARLLYLQPKFAVLDEATSALTEEAEGQLYNACKQQG 568

  Fly   624 ITLFTVSHRKSLWAHHDYYLQFDGRGSYEFATIDQ 658
            :||.::.||.:|..|||..|:..|.|.:|.:.:.:
Zfish   569 MTLISLGHRSTLEKHHDVMLRLCGGGQWELSKLKE 603

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmp70NP_001259732.1 3a01203 3..653 CDD:273360 186/614 (30%)
ABC_membrane_2 63..342 CDD:284003 71/286 (25%)
ABCD_peroxisomal_ALDP 446..651 CDD:213190 89/212 (42%)
abcd4NP_001070185.2 ABC_membrane 14..292 CDD:294371 71/286 (25%)
YddA 18..603 CDD:226646 186/619 (30%)
ABCD_peroxisomal_ALDP 385..596 CDD:213190 91/226 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4178
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D146647at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126726
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.