DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pmp70 and ABCD

Sequence 1:NP_001259732.1 Gene:Pmp70 FlyBaseID:FBgn0031069 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001245409.1 Gene:ABCD FlyBaseID:FBgn0039890 Length:730 Species:Drosophila melanogaster

Alignment Length:698 Identity:247/699 (35%)
Similarity:386/699 (55%) Gaps:58/699 (8%)


  Fly     7 KLANNQSAIVGVAGMTAALWIIAYGKMSNKKRKPGYED-KI----QYTIAEKKDKKAG----KAH 62
            |..|..|::....|.|       .|::|...|....|| |:    :..:|::..|||.    :..
  Fly    47 KNVNTTSSVRTQKGKT-------NGQLSPSTRDSSEEDFKLAEAEKLLVAQQLKKKATNNLVEPG 104

  Fly    63 VNSVFFKQLRQLLPILIPGFWSVETGLLFLVAAALIGRSVSDIWMIQNATVVESTIIHMNRTKFK 127
            :|..|.|.|:.|..|:||..:..|||||.:....||.|:...|::......:...|:..:..:|.
  Fly   105 LNKEFLKHLQMLAKIMIPQAFCYETGLLSVHTFCLISRTFLSIYVAALEGALVKFIVRKDIKQFA 169

  Fly   128 TALLKYL-TALPAISVVTNVLKWSLGELKLRFRTNLTHHLYSQYLNGYTYYKMSNLDNRIANADQ 191
            ..|||:. .|:|| :.|.:::::...:|.|.|||.|..|.|..|.....||::||||.||.|||.
  Fly   170 LVLLKWFGIAIPA-TFVNSMIRFLESKLSLAFRTRLVRHSYRLYFKNQNYYRVSNLDGRIENADH 233

  Fly   192 LLTTDIDKFCESATDLYSNISKPVLDIFIYVYRLTVNLGGKTPSILMLYLLFAGVF-----LTRL 251
            .||.||..|..|...|||:::||..|:.:....|..:......:|:....|..||.     :.|:
  Fly   234 RLTEDISVFANSVAHLYSSLTKPCFDLMLIGLALMRSSKKMKANIITGPALSIGVIALTAHILRI 298

  Fly   252 RRPT-GRLTVEEQKLEGEFRYVNSRLITNSEEVAFYQGNVREKLTLLASYSKLRSHLRKFLEFRV 315
            ..|. |:|..||....|..|:::||:|||:||:|||.|:..|...|..:|::|.:.:......::
  Fly   299 VSPKFGQLVSEEANRYGYLRHIHSRIITNAEEIAFYGGHKVEMQQLRQAYNRLVNQMTTIFNQKL 363

  Fly   316 SMGIIDNIIGKYFASIVGFYAVSIPFFSENHPLLSGENSG---------------QRLQAYYTYG 365
            ...:::....||..|..|...||:       |:|:|.:.|               :|.|...|..
  Fly   364 WFIMLEQFFMKYVWSGTGMIMVSL-------PILTGSDVGLGTVPNTAISESRVSERTQYLTTAR 421

  Fly   366 RMLVKLAEAIGRLVLAGREMSRLAGFTARMTELIKVLSDLNKGTYERTMVNGNNLAQNAVGSASS 430
            .:|:..|:||.||:.:.:|:..|||:|.|:..::.|..:...|.|.:|.|..:|.:...:  ...
  Fly   422 NLLISAADAIERLMSSYKEIVSLAGYTFRVAGMMDVFEETALGVYCKTSVMESNQSNGII--EFR 484

  Fly   431 NFGP-NKGIMCFEDN----IIRFEKVPLVTPNGDVLLQELSFEVKSGTNVLVCGPNGCGKSSLFR 490
            |..| .||.:.:.|:    .|....||:||||.|:::.:|:..::.|.::|:.||||||||||||
  Fly   485 NGKPIAKGRIIYSDDPKNMSISLRAVPVVTPNCDIVVPKLTLCIEPGVHLLITGPNGCGKSSLFR 549

  Fly   491 ILGELWPTWGGKVTKPSRGK----LFYVPQRPYMTLGTLRDQIIYPHTRDDMRRLGHSDEDLMHY 551
            ||..|||.:.|::..|...|    :||:||||||::|:|.||||||.||:||:|...::.:|...
  Fly   550 ILSGLWPIYAGELHIPRPVKDVPCMFYIPQRPYMSIGSLCDQIIYPDTREDMKRKHITENELRSI 614

  Fly   552 LDIVQLTYLEQRENGLDSIEDWIDVLSGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGKMY 616
            |.:|.|.::.||:: .|.:.||.|:||||||||:|:||||||:|::|:|||||||||:|||..:|
  Fly   615 LKMVSLEHIAQRDS-FDVVRDWKDILSGGEKQRMAIARLFYHRPRYALLDECTSAVSIDVESSIY 678

  Fly   617 SYCREVGITLFTVSHRKSLWAHHDYYLQFDGRGSYEFATIDQDKDHFG 664
            ...:.:||||.|::||.:||.:|.:.|:|||.|:::|..::.|::..|
  Fly   679 EIAKGMGITLLTITHRPTLWKYHTHILEFDGLGNWQFRKMNSDEEQKG 726

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmp70NP_001259732.1 3a01203 3..653 CDD:273360 244/686 (36%)
ABC_membrane_2 63..342 CDD:284003 92/286 (32%)
ABCD_peroxisomal_ALDP 446..651 CDD:213190 107/209 (51%)
ABCDNP_001245409.1 3a01203 75..715 CDD:273360 236/651 (36%)
ABC_membrane_2 105..390 CDD:284003 93/293 (32%)
ABCD_peroxisomal_ALDP 505..713 CDD:213190 107/209 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C57153089
eggNOG 1 0.900 E1_COG4178
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 324 1.000 Inparanoid score I440
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D146647at33208
OrthoFinder 1 1.000 FOG0000531
orthoMCL 1 0.900 OOG5_126726
Panther 1 1.100 P PTHR11384
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3716
87.920

Return to query results.
Submit another query.