DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pmp70 and abcd3a

Sequence 1:NP_001259732.1 Gene:Pmp70 FlyBaseID:FBgn0031069 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_998647.1 Gene:abcd3a ZFINID:ZDB-GENE-040426-2868 Length:656 Species:Danio rerio

Alignment Length:668 Identity:378/669 (57%)
Similarity:490/669 (73%) Gaps:15/669 (2%)


  Fly     1 MAPALSKLANNQSAIVGVAGMTAALWIIAYGKMS---NKKRKPGYEDKIQYTIAEKKDKKAGKAH 62
            ||.....|....||:.|  |:...|:|:...:.:   |:|:....|      :..:||.|..:|.
Zfish     1 MAAVSKYLTAKNSAVAG--GVLLVLYILKQRRRAAALNRKKGSANE------LNSEKDGKKERAA 57

  Fly    63 VNSVFFKQLRQLLPILIPGFWSVETGLLFLVAAALIGRSVSDIWMIQNATVVESTIIHMNRTKFK 127
            |:.:||.::.::|.|::|.|:|.||..|.|:|..|:.|:..|:|||||.|::||.||..:...||
Zfish    58 VDKLFFIRISRILKIMVPKFFSKETWYLLLIAVMLVTRTYCDVWMIQNGTMIESAIIGRSTKGFK 122

  Fly   128 TALLKYLTALPAISVVTNVLKWSLGELKLRFRTNLTHHLYSQYLNGYTYYKMSNLDNRIANADQL 192
            ..|..::||:|..::|.|.||..|.||||.||..||.|||.:||.|||||||.||||||||||||
Zfish   123 KYLFNFMTAMPISALVNNFLKLGLNELKLCFRVRLTKHLYDEYLKGYTYYKMGNLDNRIANADQL 187

  Fly   193 LTTDIDKFCESATDLYSNISKPVLDIFIYVYRLTVNLGGKTPSILMLYLLFAGVFLTRLRRPTGR 257
            ||.|:::||.|..|||||:|||:|||.:|:::||..:|.:.|:.:|.|||.:|:||||||||.|:
Zfish   188 LTQDVERFCNSVVDLYSNLSKPLLDIGLYIFKLTTAIGAQGPATMMAYLLISGLFLTRLRRPIGK 252

  Fly   258 LTVEEQKLEGEFRYVNSRLITNSEEVAFYQGNVREKLTLLASYSKLRSHLRKFLEFRVSMGIIDN 322
            :||.|||.|||:|||||||||||||:|||.||.|||.|:.:::.||..||..|:.||.|||::|:
Zfish   253 MTVTEQKYEGEYRYVNSRLITNSEEIAFYNGNTREKQTIHSTFKKLVDHLHNFIFFRFSMGMVDS 317

  Fly   323 IIGKYFASIVGFYAVSIPFFSENHPLLSGENSGQRLQAYYTYGRMLVKLAEAIGRLVLAGREMSR 387
            ||.||||::||:..||.||.:.:|......:..:.|:.||..||||:::::|:||:|||||||:|
Zfish   318 IIAKYFATVVGYLVVSRPFLNLSHSRHLNSSHAELLEDYYQSGRMLLRMSQALGRIVLAGREMTR 382

  Fly   388 LAGFTARMTELIKVLSDLNKGTYERTMVNGNNLAQNAVGSASSNFGPNKGIMCFEDNIIRFEKVP 452
            |:|||||:|||::||.:||.|.||||||:.:.  ::|  |......|..|.:...||||:|:..|
Zfish   383 LSGFTARITELMRVLKELNSGKYERTMVSQSE--KDA--SEKLTLVPGSGRIINIDNIIKFDHTP 443

  Fly   453 LVTPNGDVLLQELSFEVKSGTNVLVCGPNGCGKSSLFRILGELWPTWGGKVTKPSRGKLFYVPQR 517
            |.|||||||:::|.||||||||||||||||||||||||:||||||.:||.:|||.||||||||||
Zfish   444 LATPNGDVLIRDLCFEVKSGTNVLVCGPNGCGKSSLFRVLGELWPLFGGNLTKPERGKLFYVPQR 508

  Fly   518 PYMTLGTLRDQIIYPHTRDDMRRLGHSDEDLMHYLDIVQLTYLEQRENGLDSIEDWIDVLSGGEK 582
            ||||||:||||:|||.|.:..::.|.||..|..|||.|||.::..||...|:::||:||||||||
Zfish   509 PYMTLGSLRDQVIYPDTHESQKKKGISDLVLKEYLDNVQLGHILDREGSWDTVQDWMDVLSGGEK 573

  Fly   583 QRIAMARLFYHKPQFAILDECTSAVSVDVEGKMYSYCREVGITLFTVSHRKSLWAHHDYYLQFDG 647
            ||:|||||||||||||||||||||||||||..:||:||:|||||||||||||||.||:|||..||
Zfish   574 QRMAMARLFYHKPQFAILDECTSAVSVDVEDYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDG 638

  Fly   648 RGSYEFATIDQDKDHFGS 665
            ||:|||..|..:...|||
Zfish   639 RGNYEFKPITPETVEFGS 656

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmp70NP_001259732.1 3a01203 3..653 CDD:273360 371/653 (57%)
ABC_membrane_2 63..342 CDD:284003 158/279 (57%)
ABCD_peroxisomal_ALDP 446..651 CDD:213190 151/205 (74%)
abcd3aNP_998647.1 3a01203 1..644 CDD:273360 373/655 (57%)
ABC_membrane_2 58..337 CDD:284003 158/279 (57%)
ABCD_peroxisomal_ALDP 437..642 CDD:213190 151/205 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56242263
eggNOG 1 0.900 E1_COG4178
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2140
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D146647at33208
OrthoFinder 1 1.000 FOG0000531
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126726
Panther 1 1.100 LDO PTHR11384
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.