DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pmp70 and Abcd1

Sequence 1:NP_001259732.1 Gene:Pmp70 FlyBaseID:FBgn0031069 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001102291.1 Gene:Abcd1 RGDID:1562128 Length:737 Species:Rattus norvegicus

Alignment Length:705 Identity:259/706 (37%)
Similarity:395/706 (56%) Gaps:70/706 (10%)


  Fly     3 PALSKLANNQSAIVGVAGMTAALWIIAYG---------KMSNKKRKPGYEDKIQYTIAEKKDKKA 58
            |.|| ..:..|.:..:......|.:.|||         :.....|.|      |....|...:.:
  Rat     2 PVLS-TPSRPSRVTTLKRTAVVLALTAYGVHKIYPLVRQCLTPARGP------QVPAGESTQEAS 59

  Fly    59 G----KAHVNSVFFKQLRQLLPILIPGFWSVETGLLFLVAAALIGRSVSDIWMIQNATVVESTII 119
            |    ||.:|.||.::|..||.:|.||....|||||.|.:|||:.|:...:::.:....:...|:
  Rat    60 GATTAKAGMNRVFLQRLLVLLRLLFPGVLCRETGLLALHSAALVSRTFLSVYVARLDGRLARCIV 124

  Fly   120 HMNRTKFKTALLKY-LTALPAISVVTNVLKWSLGELKLRFRTNLTHHLYSQYLNGYTYYKMSNLD 183
            ..:...|...||:: |.|||| :.:.:.:::..|:|.|.||:.|..|.|..|.:..|||::||:|
  Rat   125 RKDPRAFSWQLLQWLLIALPA-TFINSAIRYLEGQLALSFRSRLVAHAYGLYFSQQTYYRVSNMD 188

  Fly   184 NRIANADQLLTTDIDKFCESATDLYSNISKPVLDIFIYVYRL-----TVNLGGKTPSILMLYLLF 243
            .|:.|.||.||.|:..|..|...||||::||:||:.:..|.|     :...|...||.:...::|
  Rat   189 GRLRNPDQSLTEDMVAFAASVAHLYSNLTKPLLDVAVTSYTLLRAARSRGAGTAWPSAIAGLVVF 253

  Fly   244 AGVFLTRLRRPT-GRLTVEEQKLEGEFRYVNSRLITNSEEVAFYQGNVREKLTLLASYSKLRSHL 307
            ....:.|...|. |.|..||.:.:||.||::||::.||||:|||.|:..|...|..||..|.|.:
  Rat   254 LTANVLRAFSPKFGELVAEEARRKGELRYMHSRVVANSEEIAFYGGHEVELALLQHSYQDLASQI 318

  Fly   308 RKFLEFRVSMGIIDNIIGKYFASIVGFYAVSIPF-----FSENH---------PLLSGENSGQRL 358
            ...|..|:...:::..:.||..|..|...|::|.     ::|:.         .:...|...:|.
  Rat   319 NLILLERLWYVMLEQFLMKYVWSASGLLMVAVPIITATGYAESDSEAMKKAALEMKEEELVSERT 383

  Fly   359 QAYYTYGRMLVKLAEAIGRLVLAGREMSRLAGFTARMTELIKVLSDLNKGTYERTMVNGNNLAQN 423
            :|:.....:|...|:|..|::.:.:|::.|||:|||:.|:.:|..|:....::||    .:|.:.
  Rat   384 EAFTIARNLLTAAADATERIMSSYKEVTELAGYTARVYEMFQVFEDVQHCRFKRT----GDLEEA 444

  Fly   424 AVGSASSNF------GPNK----------GIMCFEDNIIRFEKVPLVTPNGDVLLQELSFEVKSG 472
            ..|..|...      ||.|          ||:|        |.:|::||.|:|::..|:..|:.|
  Rat   445 QAGPGSMVHSGVHIEGPLKIQGQVVDVEQGIIC--------ENIPIITPTGEVVVASLNIRVEEG 501

  Fly   473 TNVLVCGPNGCGKSSLFRILGELWPTWGGKVTKPSRGKLFYVPQRPYMTLGTLRDQIIYPHTRDD 537
            .::|:.|||||||||||||||.||||:.|.:.||...::||:||||||::|:||||:|||.:.:|
  Rat   502 MHLLITGPNGCGKSSLFRILGGLWPTYSGVLYKPPPQRMFYIPQRPYMSVGSLRDQVIYPDSAED 566

  Fly   538 MRRLGHSDEDLMHYLDIVQLTYLEQRENGLDSIEDWIDVLSGGEKQRIAMARLFYHKPQFAILDE 602
            |||.|.|::.|...|.||.|.::.|||.|.:::.||.|||||||||||.|||:|||:|::|:|||
  Rat   567 MRRKGCSEQQLEAILGIVHLRHILQREGGWEAVCDWKDVLSGGEKQRIGMARMFYHRPKYALLDE 631

  Fly   603 CTSAVSVDVEGKMYSYCREVGITLFTVSHRKSLWAHHDYYLQFDGRGSYEFATID 657
            ||||||:|||||::...::.||:|.:::||.|||.:|.:.|||||.|.::|..:|
  Rat   632 CTSAVSIDVEGKIFQAAKDAGISLLSITHRPSLWKYHTHLLQFDGEGGWKFEKLD 686

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmp70NP_001259732.1 3a01203 3..653 CDD:273360 257/700 (37%)
ABC_membrane_2 63..342 CDD:284003 100/291 (34%)
ABCD_peroxisomal_ALDP 446..651 CDD:213190 113/205 (55%)
Abcd1NP_001102291.1 3a01203 1..682 CDD:273360 257/700 (37%)
Interaction with PEX19. {ECO:0000250|UniProtKB:P33897} 68..187 42/120 (35%)
PEX19 binding site and required for peroxisomal targeting. {ECO:0000250|UniProtKB:P33897} 68..85 7/17 (41%)
Required for homodimerization. {ECO:0000250|UniProtKB:P33897} 659..737 14/29 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D146647at33208
OrthoFinder 1 1.000 FOG0000531
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.