DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pmp70 and Abcd4

Sequence 1:NP_001259732.1 Gene:Pmp70 FlyBaseID:FBgn0031069 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001013118.2 Gene:Abcd4 RGDID:1307273 Length:606 Species:Rattus norvegicus

Alignment Length:619 Identity:172/620 (28%)
Similarity:300/620 (48%) Gaps:67/620 (11%)


  Fly    63 VNSVFFKQLRQLLPILIPGFWSVETGLLF--LVAAALIGRSVSDIWMIQNATVVESTIIHMNRTK 125
            :..|||..            ||.:..|:|  |:..||:.:.|     |....::.|....:...|
  Rat    27 IQKVFFPS------------WSSQNVLMFMTLLCVALLEQLV-----IYQVGLIPSQYYGVLGNK 74

  Fly   126 ----FKTALLKYLTALPAISVVTNVLK----WSLGELKLRFRTNLTHHLYSQYLNGYTYYKMSNL 182
                ||.  |.:|..  |:.|:.:.||    ::...|.:.:|.:||.||:..|.....||.::.|
  Rat    75 DLDGFKA--LTFLAV--ALIVLNSTLKSFDQFTCNLLYVSWRKDLTEHLHQLYFRARVYYTLNVL 135

  Fly   183 DNRIANADQLLTTDIDKFCESATDLYSNISKPVLDIFIYVYRLTVNLGGKTPSILMLYLLFAGVF 247
            .:.|.|.||.::.|:::||...:.:.|.:......:..|.|:...:.|...|..:..|.:...:.
  Rat   136 RDDIDNPDQRISQDVERFCRQLSSVTSKLIISPFTLAYYTYQCFQSTGWLGPVSIFGYFILGTMV 200

  Fly   248 LTRLRRPTGRLTVEEQKLEGEFRYVNSRLITNSEEVAFYQGNVREKLTLLASYSKLRSHLRKFLE 312
            ...|..|.....|:::||||:||:.:.::..|:|..|||:..:.|.:.......:|....|:.:.
  Rat   201 NKTLMGPIVTKLVQQEKLEGDFRFKHMQIRVNAEPAAFYRAGLVEHMRTDRRLQRLLQTQRELMS 265

  Fly   313 FRVSMGIIDNIIGKYFASIVGFYAVSIPFFSENHPLLSGENSGQRLQAYYTYGRML-VKLAEAIG 376
            ..:.:.|..|.. .|..||:.:..::||.|..    :.|:.|...|....:....: :.|.....
  Rat   266 RELWLYIGINTF-DYLGSILSYVVIAIPIFRG----VYGDLSPTELSTLVSKNAFVCIYLISCFT 325

  Fly   377 RLVLAGREMSRLAGFTARMTELIKVLSDLNKGTYERTMVNGNNLAQNAVGSASSNFGPNKGIMCF 441
            :|:.....:|.:||:|.|:.||.:.|.|:::.:::          ...:|.:..:.....|....
  Rat   326 QLIDLSTTLSDVAGYTHRIGELQEALLDMSRKSHD----------CETLGESEWDLDKAPGWPTT 380

  Fly   442 E--DNIIRFEKVPLVTPNGD-VLLQELSFEVKSGTNVLVCGPNGCGKSSLFRILGELWPTWGGKV 503
            |  |.....::|.::.|:.| .|:::||.::..|.::|:.|..|.||:||.|:||.||.:..|.|
  Rat   381 EPSDTAFLLDRVSILAPSSDKPLIKDLSLKICEGQSLLITGNTGTGKTSLLRVLGGLWESMKGSV 445

  Fly   504 TKPS----RGKLFYVPQRPYMTLGTLRDQIIYPHTRDDMRRL-----GHSDEDLMHYLDIVQLTY 559
            ...:    .|.|| :||:|:.|.||||:|:|||     ::.:     ...||.::.:|::..|:.
  Rat   446 QMLADFGPHGVLF-LPQKPFFTDGTLREQVIYP-----LKEIYPDSGSADDERIVRFLELAGLSS 504

  Fly   560 LEQRENGLDSIED--WIDVLSGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGKMYSYCREV 622
            |..|..|||...|  |.||||.||.||::.|||||.:|::|:|||.|||::.:.|.::|...:::
  Rat   505 LVARTGGLDQQVDWNWYDVLSPGEMQRLSFARLFYLQPKYAVLDEATSALTEEAESELYRIGQQL 569

  Fly   623 GITLFTVSHRKSLWAHHDYYLQFDGRGSYEFATI 656
            |:|..:|.||.||...|.:.|:..|.||:|...|
  Rat   570 GMTFISVGHRPSLEKFHSWVLRLHGGGSWELTRI 603

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmp70NP_001259732.1 3a01203 3..653 CDD:273360 171/615 (28%)
ABC_membrane_2 63..342 CDD:284003 69/289 (24%)
ABCD_peroxisomal_ALDP 446..651 CDD:213190 82/217 (38%)
Abcd4NP_001013118.2 3a01203 9..600 CDD:273360 171/615 (28%)
ABC_membrane_2 16..294 CDD:284003 69/289 (24%)
ABCD_peroxisomal_ALDP 387..598 CDD:213190 82/217 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4178
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D146647at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126726
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.