DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pmp70 and Abcd2

Sequence 1:NP_001259732.1 Gene:Pmp70 FlyBaseID:FBgn0031069 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_036124.2 Gene:Abcd2 MGIID:1349467 Length:741 Species:Mus musculus

Alignment Length:689 Identity:266/690 (39%)
Similarity:394/690 (57%) Gaps:64/690 (9%)


  Fly    17 GVAGMTAALWIIAYGK------MSNKKRKPGY-EDKIQ-YTIAEKKD---------KKAGKAHVN 64
            |.|...|.|...||..      :..:.::||: :.|.: |:.||.::         ||.... :|
Mouse    18 GAAKRAACLVAAAYALKTLYPIIGKRLKQPGHRKAKAEAYSPAENREILHCTEIICKKPAPG-LN 81

  Fly    65 SVFFKQLRQLLPILIPGFWSVETGLLFLVAAALIGRSVSDIWMI-QNATVVESTIIHMNRTKFKT 128
            :.|||||.:|..||.|...:.|||.|.|.:.|||.|:...|::. .:..:|:|.:....|| |..
Mouse    82 AAFFKQLLELRKILFPKLVTTETGWLCLHSVALISRTFLSIYVAGLDGKIVKSIVEKKPRT-FII 145

  Fly   129 ALLKYL-TALPAISVVTNVLKWSLGELKLRFRTNLTHHLYSQYLNGYTYYKMSNLDNRIANADQL 192
            .|:|:| .|:|| :.|.:.:::...:|.|.|||.|..|.|..|....||||:.|:|.|:||.||.
Mouse   146 KLIKWLMIAIPA-TFVNSAIRYLECKLALAFRTRLVDHAYETYFANQTYYKVINMDGRLANPDQS 209

  Fly   193 LTTDIDKFCESATDLYSNISKPVLDIFIYVYRL--TVNLGGKT---PSILMLYLLFAGVFLTRLR 252
            ||.||..|.:|...||||::||:||:.:..|.|  |....|.:   |::|...:::|...:.:..
Mouse   210 LTEDIMMFSQSVAHLYSNLTKPILDVILTSYTLIRTATSRGASPIGPTLLAGLVVYATAKVLKAC 274

  Fly   253 RPT-GRLTVEEQKLEGEFRYVNSRLITNSEEVAFYQGNVREKLTLLASYSKLRSHLRKFLEFRVS 316
            .|. |.|..||...:|..|||:||:|.|.||:|||:|:..|...|...|..|...:...|..|:.
Mouse   275 SPKFGSLVAEEAHRKGYLRYVHSRIIANVEEIAFYRGHKVEMKQLQKCYKALAYQMNLILSKRLW 339

  Fly   317 MGIIDNIIGKYFASIVGFYAVSIPFFS---------ENHP---LLSGENSGQRLQAYYTYGRMLV 369
            ..:|:..:.||..|..|...|:||..:         |:.|   ::|     .|.:|:.|...:|.
Mouse   340 YIMIEQFLMKYVWSSCGLIMVAIPIITATGFADGDLEDGPKQAMVS-----DRTEAFTTARNLLA 399

  Fly   370 KLAEAIGRLVLAGREMSRLAGFTARMTELIKVLSDLNKGTYERTMV--------NGNNL---AQN 423
            ..|:||.|::.:.:|::.|||:|||:..:..|..::.:|.|:||:.        .|.||   ..:
Mouse   400 SGADAIERIMSSYKEITELAGYTARVYNMFWVFDEVKRGIYKRTVTQEPENHSKRGGNLELPLSD 464

  Fly   424 AVGSASSNFGPNKGIMCFEDNIIRFEKVPLVTPNGDVLLQELSFEVKSGTNVLVCGPNGCGKSSL 488
            .:....:....:.||:|        |.||::||.|:|:...|:|:|:.|.::|:.||||||||||
Mouse   465 TLAIKGTVIDVDHGIIC--------ENVPIITPAGEVVASRLNFKVEEGMHLLITGPNGCGKSSL 521

  Fly   489 FRILGELWPTWGGKVTKPSRGKLFYVPQRPYMTLGTLRDQIIYPHTRDDMRRLGHSDEDLMHYLD 553
            ||||..|||.:.|.:.||....:||:||||||:||:||||:|||.:.||||..|::|:||...|.
Mouse   522 FRILSGLWPVYEGVLYKPPPQHMFYIPQRPYMSLGSLRDQVIYPDSADDMREKGYTDQDLERILH 586

  Fly   554 IVQLTYLEQRENGLDSIEDWIDVLSGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGKMYSY 618
            .|.|.::.|||.|.|::.||.||||||||||:.|||:|||||::|:|||||||||:|||||::..
Mouse   587 SVHLYHIVQREGGWDAVMDWKDVLSGGEKQRMGMARMFYHKPKYALLDECTSAVSIDVEGKIFQA 651

  Fly   619 CREVGITLFTVSHRKSLWAHHDYYLQFDGRGSYEFATID 657
            ....||:|.:::||.|||.:|.:.|||||.|.:.|..:|
Mouse   652 AIGAGISLLSITHRPSLWKYHTHLLQFDGEGGWRFEQLD 690

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmp70NP_001259732.1 3a01203 3..653 CDD:273360 264/684 (39%)
ABC_membrane_2 63..342 CDD:284003 106/287 (37%)
ABCD_peroxisomal_ALDP 446..651 CDD:213190 115/205 (56%)
Abcd2NP_036124.2 Interaction with PEX19. {ECO:0000250} 1..218 71/203 (35%)
3a01203 74..686 CDD:273360 252/628 (40%)
ABC_membrane_2 80..365 CDD:284003 106/287 (37%)
ABCD_peroxisomal_ALDP 479..684 CDD:213190 117/213 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4178
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D146647at33208
OrthoFinder 1 1.000 FOG0000531
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126726
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3716
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.