DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pmp70 and Abcd3

Sequence 1:NP_001259732.1 Gene:Pmp70 FlyBaseID:FBgn0031069 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_036936.1 Gene:Abcd3 RGDID:2007 Length:659 Species:Rattus norvegicus

Alignment Length:670 Identity:384/671 (57%)
Similarity:487/671 (73%) Gaps:21/671 (3%)


  Fly     4 ALSK--LANNQSAIVGVAGMTAALWII------AYGKMSNKKRKPGYEDKIQYTIAEKKDKKAGK 60
            |.||  .|.|.|    :||....|:.:      |.|....|..||..::.      ||:.||. :
  Rat     3 AFSKYLTARNSS----LAGAAFLLFCLLHKRRRALGLHGKKSGKPPLQNN------EKEGKKE-R 56

  Fly    61 AHVNSVFFKQLRQLLPILIPGFWSVETGLLFLVAAALIGRSVSDIWMIQNATVVESTIIHMNRTK 125
            |.|:.||..:|.|:|.|::|..:..|||.|.|:|..|:.|:..|:|||||.|::||.||..:...
  Rat    57 AVVDKVFLSRLSQILKIMVPRTFCKETGYLILIAVMLVSRTYCDVWMIQNGTLIESGIIGRSSKD 121

  Fly   126 FKTALLKYLTALPAISVVTNVLKWSLGELKLRFRTNLTHHLYSQYLNGYTYYKMSNLDNRIANAD 190
            ||..|..::.|:|.||:|.|.||:.|.||||.||..||.:||.:||..:|||||.||||||||.|
  Rat   122 FKRYLFNFIAAMPLISLVNNFLKYGLNELKLCFRVRLTRYLYEEYLQAFTYYKMGNLDNRIANPD 186

  Fly   191 QLLTTDIDKFCESATDLYSNISKPVLDIFIYVYRLTVNLGGKTPSILMLYLLFAGVFLTRLRRPT 255
            ||||.|::|||.|..|||||:|||.|||.:|:::||..:|.:.|:.:|.|||.:|:||||||||.
  Rat   187 QLLTQDVEKFCNSVVDLYSNLSKPFLDIVLYIFKLTSAIGAQGPASMMAYLLVSGLFLTRLRRPI 251

  Fly   256 GRLTVEEQKLEGEFRYVNSRLITNSEEVAFYQGNVREKLTLLASYSKLRSHLRKFLEFRVSMGII 320
            |::|:.|||.|||:|:|||||||||||:|||.||.|||.|:.:.:.||..||..|:.||.|||.|
  Rat   252 GKMTIMEQKYEGEYRFVNSRLITNSEEIAFYNGNKREKQTIHSVFRKLVEHLHNFIFFRFSMGFI 316

  Fly   321 DNIIGKYFASIVGFYAVSIPFFSENHPLLSGENSGQRLQAYYTYGRMLVKLAEAIGRLVLAGREM 385
            |:||.||.|::||:..||.||....||........:.|:.||..||||:::::|:||:|||||||
  Rat   317 DSIIAKYIATVVGYLVVSRPFLDLAHPRHLHSTHSELLEDYYQSGRMLLRMSQALGRIVLAGREM 381

  Fly   386 SRLAGFTARMTELIKVLSDLNKGTYERTMVNGNNLAQNAVGSASSNFGPNKGIMCFEDNIIRFEK 450
            :||||||||:|||::||.|||.|.||||||:..:  :...|:.:|...|..|.:...||||:|:.
  Rat   382 TRLAGFTARITELMQVLKDLNHGKYERTMVSQQD--KGIEGAQASPLIPGAGEIINADNIIKFDH 444

  Fly   451 VPLVTPNGDVLLQELSFEVKSGTNVLVCGPNGCGKSSLFRILGELWPTWGGKVTKPSRGKLFYVP 515
            |||.|||||:|:|:|||||:||.|||:|||||||||||||:||||||.:||.:|||.||||||||
  Rat   445 VPLATPNGDILIQDLSFEVRSGANVLICGPNGCGKSSLFRVLGELWPLFGGHLTKPERGKLFYVP 509

  Fly   516 QRPYMTLGTLRDQIIYPHTRDDMRRLGHSDEDLMHYLDIVQLTYLEQRENGLDSIEDWIDVLSGG 580
            |||||||||||||:|||..::|.::.|.||:.|..|||.|||.::.:||.|.||::||:||||||
  Rat   510 QRPYMTLGTLRDQVIYPDGKEDQKKKGISDQVLKGYLDNVQLGHILEREGGWDSVQDWMDVLSGG 574

  Fly   581 EKQRIAMARLFYHKPQFAILDECTSAVSVDVEGKMYSYCREVGITLFTVSHRKSLWAHHDYYLQF 645
            ||||:|||||||||||||||||||||||||||..:||:||:|||||||||||||||.||:|||..
  Rat   575 EKQRMAMARLFYHKPQFAILDECTSAVSVDVEDYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHM 639

  Fly   646 DGRGSYEFATIDQDKDHFGS 665
            ||||:|||..|.:|...|||
  Rat   640 DGRGNYEFKKITEDTVEFGS 659

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmp70NP_001259732.1 3a01203 3..653 CDD:273360 378/657 (58%)
ABC_membrane_2 63..342 CDD:284003 155/279 (56%)
ABCD_peroxisomal_ALDP 446..651 CDD:213190 153/205 (75%)
Abcd3NP_036936.1 3a01203 1..647 CDD:273360 378/657 (58%)
Interaction with PEX19. {ECO:0000250} 2..199 92/207 (44%)
Targeting to peroxisomes. {ECO:0000250} 2..124 48/132 (36%)
ABC_membrane_2 59..338 CDD:284003 155/279 (56%)
ABCD_peroxisomal_ALDP 440..645 CDD:213190 153/205 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56242917
eggNOG 1 0.900 E1_COG4178
Hieranoid 1 1.000
Homologene 1 1.000 H2140
Inparanoid 1 1.050 757 1.000 Inparanoid score I521
OMA 1 1.010
OrthoDB 1 1.010 D146647at33208
OrthoFinder 1 1.000 FOG0000531
OrthoInspector 1 1.000 T1088673
orthoMCL 1 0.900 OOG5_126726
Panther 1 1.100 LDO PTHR11384
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.