DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pmp70 and ABCD2

Sequence 1:NP_001259732.1 Gene:Pmp70 FlyBaseID:FBgn0031069 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_005155.1 Gene:ABCD2 HGNCID:66 Length:740 Species:Homo sapiens

Alignment Length:689 Identity:266/690 (39%)
Similarity:391/690 (57%) Gaps:53/690 (8%)


  Fly     6 SKLANNQSAIVGVAGMTAALWIIAYGKMS----NKKRKPGY----EDKIQY---TIAEKKDKKAG 59
            |..|...:.:|..|.....|:.|...::.    .||:...|    ..:|.:   ||.||.     
Human    17 SSAAKRAACLVAAAYALKTLYPIIGKRLKQSGHGKKKAAAYPAAENTEILHCTETICEKP----- 76

  Fly    60 KAHVNSVFFKQLRQLLPILIPGFWSVETGLLFLVAAALIGRSVSDIWMI-QNATVVESTIIHMNR 123
            ...||:.|||||.:|..||.|...:.|||.|.|.:.|||.|:...|::. .:..:|:|.:....|
Human    77 SPGVNADFFKQLLELRKILFPKLVTTETGWLCLHSVALISRTFLSIYVAGLDGKIVKSIVEKKPR 141

  Fly   124 TKFKTALLKYL-TALPAISVVTNVLKWSLGELKLRFRTNLTHHLYSQYLNGYTYYKMSNLDNRIA 187
            | |...|:|:| .|:|| :.|.:.:::...:|.|.|||.|..|.|..|....||||:.|:|.|:|
Human   142 T-FIIKLIKWLMIAIPA-TFVNSAIRYLECKLALAFRTRLVDHAYETYFTNQTYYKVINMDGRLA 204

  Fly   188 NADQLLTTDIDKFCESATDLYSNISKPVLDIFIYVYRL--TVNLGGKT---PSILMLYLLFAGVF 247
            |.||.||.||..|.:|...||||::||:||:.:..|.|  |....|.:   |::|...:::|...
Human   205 NPDQSLTEDIMMFSQSVAHLYSNLTKPILDVMLTSYTLIQTATSRGASPIGPTLLAGLVVYATAK 269

  Fly   248 LTRLRRPT-GRLTVEEQKLEGEFRYVNSRLITNSEEVAFYQGNVREKLTLLASYSKLRSHLRKFL 311
            :.:...|. |:|..||...:|..|||:||:|.|.||:|||:|:..|...|..||..|...:...|
Human   270 VLKACSPKFGKLVAEEAHRKGYLRYVHSRIIANVEEIAFYRGHKVEMKQLQKSYKALADQMNLIL 334

  Fly   312 EFRVSMGIIDNIIGKYFASIVGFYAVSIPFFSENHPLLSGENS------GQRLQAYYTYGRMLVK 370
            ..|:...:|:..:.||..|..|...|:||..:.. ....||:.      .:|.:|:.|...:|..
Human   335 SKRLWYIMIEQFLMKYVWSSSGLIMVAIPIITAT-GFADGEDGQKQVMVSERTEAFTTARNLLAS 398

  Fly   371 LAEAIGRLVLAGREMSRLAGFTARMTELIKVLSDLNKGTYERTMV---------NGNNL---AQN 423
            .|:||.|::.:.:|::.|||:|||:..:..|..::.:|.|:||.|         ||..:   ..:
Human   399 GADAIERIMSSYKEVTELAGYTARVYNMFWVFDEVKRGIYKRTAVIQESESHSKNGAKVELPLSD 463

  Fly   424 AVGSASSNFGPNKGIMCFEDNIIRFEKVPLVTPNGDVLLQELSFEVKSGTNVLVCGPNGCGKSSL 488
            .:.........:.||:|        |.||::||.|:|:...|:|:|:.|.::|:.||||||||||
Human   464 TLAIKGKVIDVDHGIIC--------ENVPIITPAGEVVASRLNFKVEEGMHLLITGPNGCGKSSL 520

  Fly   489 FRILGELWPTWGGKVTKPSRGKLFYVPQRPYMTLGTLRDQIIYPHTRDDMRRLGHSDEDLMHYLD 553
            ||||..|||.:.|.:.||....:||:||||||:||:||||:|||.:.|||...|::|:||...|.
Human   521 FRILSGLWPVYEGVLYKPPPQHMFYIPQRPYMSLGSLRDQVIYPDSVDDMHDKGYTDQDLERILH 585

  Fly   554 IVQLTYLEQRENGLDSIEDWIDVLSGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGKMYSY 618
            .|.|.::.|||.|.|::.||.||||||||||:.|||:|||||::|:|||||||||:|||||::..
Human   586 NVHLYHIVQREGGWDAVMDWKDVLSGGEKQRMGMARMFYHKPKYALLDECTSAVSIDVEGKIFQA 650

  Fly   619 CREVGITLFTVSHRKSLWAHHDYYLQFDGRGSYEFATID 657
            .:..||:|.:::||.|||.:|.:.|||||.|.:.|..:|
Human   651 AKGAGISLLSITHRPSLWKYHTHLLQFDGEGGWRFEQLD 689

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmp70NP_001259732.1 3a01203 3..653 CDD:273360 264/684 (39%)
ABC_membrane_2 63..342 CDD:284003 108/287 (38%)
ABCD_peroxisomal_ALDP 446..651 CDD:213190 114/205 (56%)
ABCD2NP_005155.1 Interaction with PEX19 1..218 72/208 (35%)
3a01203 74..685 CDD:273360 252/627 (40%)
ABC_membrane_2 80..365 CDD:284003 108/287 (38%)
ABCD_peroxisomal_ALDP 478..683 CDD:213190 116/213 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4178
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000531
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126726
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3716
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.