DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pmp70 and ABCD1

Sequence 1:NP_001259732.1 Gene:Pmp70 FlyBaseID:FBgn0031069 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_000024.2 Gene:ABCD1 HGNCID:61 Length:745 Species:Homo sapiens

Alignment Length:642 Identity:251/643 (39%)
Similarity:380/643 (59%) Gaps:60/643 (9%)


  Fly    58 AGKAHVNSVFFKQLRQLLPILIPGFWSVETGLLFLVAAALIGRSVSDIWMIQNATVVESTIIHMN 122
            |.||.:|.||.::|..||.:|.|.....|||||.|.:|||:.|:...:::.:....:...|:..:
Human    62 AAKAGMNRVFLQRLLWLLRLLFPRVLCRETGLLALHSAALVSRTFLSVYVARLDGRLARCIVRKD 126

  Fly   123 RTKFKTALLKY-LTALPAISVVTNVLKWSLGELKLRFRTNLTHHLYSQYLNGYTYYKMSNLDNRI 186
            ...|...||:: |.|||| :.|.:.:::..|:|.|.||:.|..|.|..|.:..|||::||:|.|:
Human   127 PRAFGWQLLQWLLIALPA-TFVNSAIRYLEGQLALSFRSRLVAHAYRLYFSQQTYYRVSNMDGRL 190

  Fly   187 ANADQLLTTDIDKFCESATDLYSNISKPVLDIFIYVYRL-----TVNLGGKTPSILMLYLLFAGV 246
            .|.||.||.|:..|..|...||||::||:||:.:..|.|     :...|...||.:...::|...
Human   191 RNPDQSLTEDVVAFAASVAHLYSNLTKPLLDVAVTSYTLLRAARSRGAGTAWPSAIAGLVVFLTA 255

  Fly   247 FLTRLRRPT-GRLTVEEQKLEGEFRYVNSRLITNSEEVAFYQGNVREKLTLLASYSKLRSHLRKF 310
            .:.|...|. |.|..||.:.:||.||::||::.||||:|||.|:..|...|..||..|.|.:...
Human   256 NVLRAFSPKFGELVAEEARRKGELRYMHSRVVANSEEIAFYGGHEVELALLQRSYQDLASQINLI 320

  Fly   311 LEFRVSMGIIDNIIGKYFASIVGFYAVSIPF-----FSEN--------------HPLLSGENSGQ 356
            |..|:...:::..:.||..|..|...|::|.     :||:              ..|:|     :
Human   321 LLERLWYVMLEQFLMKYVWSASGLLMVAVPIITATGYSESDAEAVKKAALEKKEEELVS-----E 380

  Fly   357 RLQAYYTYGRMLVKLAEAIGRLVLAGREMSRLAGFTARMTELIKVLSDLNKGTYERTMVNGNNLA 421
            |.:|:.....:|...|:||.|::.:.:|::.|||:|||:.|:.:|..|:.:..::|.    ..|.
Human   381 RTEAFTIARNLLTAAADAIERIMSSYKEVTELAGYTARVHEMFQVFEDVQRCHFKRP----RELE 441

  Fly   422 QNAVGSASSN------FGPNK----------GIMCFEDNIIRFEKVPLVTPNGDVLLQELSFEVK 470
            ....||.:..      .||.|          ||:|        |.:|:|||:|:|::..|:..|:
Human   442 DAQAGSGTIGRSGVRVEGPLKIRGQVVDVEQGIIC--------ENIPIVTPSGEVVVASLNIRVE 498

  Fly   471 SGTNVLVCGPNGCGKSSLFRILGELWPTWGGKVTKPSRGKLFYVPQRPYMTLGTLRDQIIYPHTR 535
            .|.::|:.|||||||||||||||.||||:||.:.||...::||:||||||::|:||||:|||.:.
Human   499 EGMHLLITGPNGCGKSSLFRILGGLWPTYGGVLYKPPPQRMFYIPQRPYMSVGSLRDQVIYPDSV 563

  Fly   536 DDMRRLGHSDEDLMHYLDIVQLTYLEQRENGLDSIEDWIDVLSGGEKQRIAMARLFYHKPQFAIL 600
            :||:|.|:|::||...||:|.|.::.|||.|.:::.||.|||||||||||.|||:|||:|::|:|
Human   564 EDMQRKGYSEQDLEAILDVVHLHHILQREGGWEAMCDWKDVLSGGEKQRIGMARMFYHRPKYALL 628

  Fly   601 DECTSAVSVDVEGKMYSYCREVGITLFTVSHRKSLWAHHDYYLQFDGRGSYEFATID 657
            ||||||||:|||||::...::.||.|.:::||.|||.:|.:.|||||.|.::|..:|
Human   629 DECTSAVSIDVEGKIFQAAKDAGIALLSITHRPSLWKYHTHLLQFDGEGGWKFEKLD 685

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmp70NP_001259732.1 3a01203 3..653 CDD:273360 249/637 (39%)
ABC_membrane_2 63..342 CDD:284003 100/291 (34%)
ABCD_peroxisomal_ALDP 446..651 CDD:213190 115/205 (56%)
ABCD1NP_000024.2 3a01203 1..681 CDD:273360 249/637 (39%)
Interaction with PEX19. {ECO:0000269|PubMed:10777694} 67..186 42/120 (35%)
PEX19 binding site and required for peroxisomal targeting. {ECO:0000269|PubMed:15781447} 67..84 7/17 (41%)
ABC_membrane_2 83..352 CDD:284003 93/270 (34%)
ABCD_peroxisomal_ALDP 474..679 CDD:213190 117/213 (55%)
Required for homodimerization. {ECO:0000269|PubMed:17609205} 658..745 14/29 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4178
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000531
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126726
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3716
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.