DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pmp70 and Abcd1

Sequence 1:NP_001259732.1 Gene:Pmp70 FlyBaseID:FBgn0031069 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_031461.1 Gene:Abcd1 MGIID:1349215 Length:736 Species:Mus musculus

Alignment Length:643 Identity:247/644 (38%)
Similarity:375/644 (58%) Gaps:50/644 (8%)


  Fly    52 EKKDKKAGKAHVNSVFFKQLRQLLPILIPGFWSVETGLLFLVAAALIGRSVSDIWMIQNATVVES 116
            |.....|.||.:|.||.::|..||.:|.|.....|||||.|.:|||:.|:...:::.:....:..
Mouse    56 EASGATATKAGMNRVFLQRLLALLRLLFPRVLCRETGLLALHSAALVSRTFLSVYVARLDGRLAR 120

  Fly   117 TIIHMNRTKFKTALLKY-LTALPAISVVTNVLKWSLGELKLRFRTNLTHHLYSQYLNGYTYYKMS 180
            .|:..:...|...||:: |.|||| :.:.:.:::..|:|.|.||:.|..|.|..|.:..|||::|
Mouse   121 CIVRKDPRAFSWQLLQWLLIALPA-TFINSAIRYLEGQLALSFRSRLVAHAYGLYFSQQTYYRVS 184

  Fly   181 NLDNRIANADQLLTTDIDKFCESATDLYSNISKPVLDIFIYVYRL-----TVNLGGKTPSILMLY 240
            |:|.|:.|.||.||.|:..|..|...||||::||:||:.:..|.|     :...|...||.:...
Mouse   185 NMDGRLRNPDQSLTEDVVAFAASVAHLYSNLTKPLLDVAVTSYTLLRAARSRGAGTAWPSAIAGL 249

  Fly   241 LLFAGVFLTRLRRPT-GRLTVEEQKLEGEFRYVNSRLITNSEEVAFYQGNVREKLTLLASYSKLR 304
            ::|....:.|...|. |.|..||.:.:||.||::||::.||||:|||.|:..|...|..||..|.
Mouse   250 VVFLTANVLRAFSPKFGELVAEEARRKGELRYMHSRVVANSEEIAFYGGHEVELALLQHSYQDLA 314

  Fly   305 SHLRKFLEFRVSMGIIDNIIGKYFASIVGFYAVSIPF-----FSENH---------PLLSGENSG 355
            |.:...|..|:...:::..:.||..|..|...|::|.     ::|:.         .:...|...
Mouse   315 SQINLILLERLWYVMLEQFLMKYVWSASGLLMVAVPIITATGYAESDSEAMKKAALEMKEEELVS 379

  Fly   356 QRLQAYYTYGRMLVKLAEAIGRLVLAGREMSRLAGFTARMTELIKVLSDLNKGTYERTMVNGNNL 420
            :|.:|:.....:|...|:|..|::.:.:|::.|||:|||:.|:.:|..|:....::||    .:|
Mouse   380 ERTEAFTIARNLLTAAADATERIMSSYKEVTELAGYTARVYEMFQVFEDVKHCRFKRT----GDL 440

  Fly   421 AQNAVG------SASSNFGPNK----------GIMCFEDNIIRFEKVPLVTPNGDVLLQELSFEV 469
            .:...|      |.....||.|          ||:|        |.:|::||.|:|::..|:..|
Mouse   441 EEAQAGPGVMVQSGVHVEGPLKIQGQVVDVEQGIIC--------ENIPIITPTGEVVVASLNIRV 497

  Fly   470 KSGTNVLVCGPNGCGKSSLFRILGELWPTWGGKVTKPSRGKLFYVPQRPYMTLGTLRDQIIYPHT 534
            :.|.::|:.|||||||||||||||.||||:.|.:.||...::||:||||||::|:||||:|||.:
Mouse   498 EEGMHLLITGPNGCGKSSLFRILGGLWPTYSGVLYKPPPQRMFYIPQRPYMSVGSLRDQVIYPDS 562

  Fly   535 RDDMRRLGHSDEDLMHYLDIVQLTYLEQRENGLDSIEDWIDVLSGGEKQRIAMARLFYHKPQFAI 599
            .:||||.|.|::.|...|.||.|.::.|||.|.:::.||.|||||||||||.|||:|||:|::|:
Mouse   563 AEDMRRKGCSEQQLEAILGIVHLRHILQREGGWEAVCDWKDVLSGGEKQRIGMARMFYHRPKYAL 627

  Fly   600 LDECTSAVSVDVEGKMYSYCREVGITLFTVSHRKSLWAHHDYYLQFDGRGSYEFATID 657
            |||||||||:|||||::...::.||.|.:::||.|||.:|.:.|||||.|.::|..:|
Mouse   628 LDECTSAVSIDVEGKIFQAAKDAGIALLSITHRPSLWKYHTHLLQFDGEGGWKFEKLD 685

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmp70NP_001259732.1 3a01203 3..653 CDD:273360 245/638 (38%)
ABC_membrane_2 63..342 CDD:284003 99/291 (34%)
ABCD_peroxisomal_ALDP 446..651 CDD:213190 113/205 (55%)
Abcd1NP_031461.1 3a01203 1..681 CDD:273360 245/638 (38%)
Interaction with PEX19. {ECO:0000250|UniProtKB:P33897} 67..186 41/120 (34%)
PEX19 binding site and required for peroxisomal targeting. {ECO:0000250|UniProtKB:P33897} 67..84 7/17 (41%)
ABC_membrane_2 83..352 CDD:284003 92/270 (34%)
ABCD_peroxisomal_ALDP 474..679 CDD:213190 115/213 (54%)
Required for homodimerization. {ECO:0000250|UniProtKB:P33897} 658..736 14/29 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4178
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D146647at33208
OrthoFinder 1 1.000 FOG0000531
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126726
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3716
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.