DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pmp70 and abcd4

Sequence 1:NP_001259732.1 Gene:Pmp70 FlyBaseID:FBgn0031069 Length:665 Species:Drosophila melanogaster
Sequence 2:XP_002938643.2 Gene:abcd4 XenbaseID:XB-GENE-1006704 Length:614 Species:Xenopus tropicalis

Alignment Length:672 Identity:182/673 (27%)
Similarity:314/673 (47%) Gaps:107/673 (16%)


  Fly    26 WIIA-YGKMSNKKRKPGYEDKIQYTIAEKKDKKAGKAHVNSVFFKQLRQLLPILIPGFWSVETGL 89
            |::| .|..|.:..:|                   :..::.||.::...|..:|.|. ||.:..|
 Frog     6 WLLANMGARSPRLERP-------------------RPRLDLVFLRRFINLCVVLFPR-WSSQNVL 50

  Fly    90 LF--LVAAALIGRSV-----------------SDIWMIQNATVVESTIIHMNRTKFKTALLKYLT 135
            :|  |:..||.|:.:                 .|:...|:.:::...:|.:|  ....::.:|::
 Frog    51 MFLTLLMVALTGQLLVYQVGILPSQFYGVLADRDLHGFQHLSIIALLLIFLN--SMLCSVEQYVS 113

  Fly   136 ALPAISVVTNVLKWSLGELKLRFRTNLTHHLYSQYLNGYTYYKMSNLDNRIANADQLLTTDIDKF 200
            .|..:|.                |.::|..|:..|.:...||.:|.....|.|.||.:|.|:::.
 Frog   114 KLAYVSC----------------RRDMTGFLHRLYFHNQVYYTLSVEHPHIDNPDQRMTQDVERL 162

  Fly   201 CESATDLYSNISKPVLDIFIYVYRLTVNLGGKTPSILMLYLLFAGVFLTRLRRPTGRLTVEEQKL 265
            |...:...|.:......:..|.|:..||.|...|..:..|.:...:....|..|.....|:::||
 Frog   163 CRELSSCASQVLTTPFTLVYYSYQCAVNTGWMGPVSIFGYFVVGSLLNKILMGPVIPKLVQQEKL 227

  Fly   266 EGEFRYVNSRLITNSEEVAFYQ-GNVREKLTLLASYSKLRSHLRKFL---------EFRVSMGII 320
            ||:|||.:.::..|:|..|||: |:|        ..|:..|.|:|.:         |..::.|  
 Frog   228 EGDFRYKHVQVRVNAEAAAFYRAGSV--------ELSRTDSRLQKLIVAQKDLINQELWLNFG-- 282

  Fly   321 DNIIGKYFASIVGFYAVSIPFFSENHPLLSGENSGQRL--QAYYTYGRMLVKLAEAIGRLVLAGR 383
            .|.. .|...|:.:..:::|.|:..:..||.....:.:  .|:.:     :.|.....:|:....
 Frog   283 TNTF-NYLGGILSYMIIAVPIFTGMYADLSPAELSELISKNAFVS-----IYLISCFSKLIDLSS 341

  Fly   384 EMSRLAGFTARMTELIKVLSDLNKGTYERTMVNGNNLAQNAVGSASSNFGPNKGIMCFEDNIIRF 448
            .:..:||:|.|:.||.:|:.||:|         .:|...|.|....:|....:......|..:..
 Frog   342 SLCDVAGYTHRIAELKEVMLDLSK---------SHNCCNNLVEPQDTNSSTLEAKSQSVDPELIL 397

  Fly   449 EKVPLVTPNGD-VLLQELSFEVKSGTNVLVCGPNGCGKSSLFRILGELWPTWGGKVTKPSR---- 508
            :.:.:.||..: .|:::||.:|..|:|:|:.|.:|.||||:.|:|..||.|..|:|:..::    
 Frog   398 DNITITTPGSECTLVRDLSLQVCEGSNILITGDSGSGKSSILRVLAGLWETKRGQVSVLTQFGPH 462

  Fly   509 GKLFYVPQRPYMTLGTLRDQIIYP--HTRDDMRRLGHSDEDLMHYLDIVQLTYLEQRENGLDSIE 571
            |.|| :||:|:::.|:||:|:|||  ....|...:  .||.::..|::..|..|..|..|||...
 Frog   463 GVLF-LPQKPFLSDGSLREQVIYPLKEVYPDSGWV--DDERILKSLEMAGLVPLINRTGGLDQKV 524

  Fly   572 D--WIDVLSGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGKMYSYCREVGITLFTVSHRKS 634
            |  |.:|||.||.||:|..||||.:|::|:|||.:||:|...|.|:|..|:|:|:||.:|.||:|
 Frog   525 DWNWAEVLSPGEMQRLAFTRLFYLQPKYAVLDEVSSALSEQAEDKLYRGCQELGMTLISVGHRQS 589

  Fly   635 LWAHHDYYLQFDGRGSYEFATI 656
            |...||:.|:....|.:||..|
 Frog   590 LQKFHDWELRVGSDGHWEFKRI 611

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmp70NP_001259732.1 3a01203 3..653 CDD:273360 180/668 (27%)
ABC_membrane_2 63..342 CDD:284003 69/308 (22%)
ABCD_peroxisomal_ALDP 446..651 CDD:213190 84/214 (39%)
abcd4XP_002938643.2 ABC_membrane 25..303 CDD:294371 69/308 (22%)
YddA 42..607 CDD:226646 170/612 (28%)
ABCD_peroxisomal_ALDP 395..606 CDD:213190 84/214 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4178
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D146647at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.