DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pmp70 and abcd3b

Sequence 1:NP_001259732.1 Gene:Pmp70 FlyBaseID:FBgn0031069 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001124092.1 Gene:abcd3b ZFINID:ZDB-GENE-050517-29 Length:659 Species:Danio rerio

Alignment Length:671 Identity:373/672 (56%)
Similarity:481/672 (72%) Gaps:18/672 (3%)


  Fly     1 MAPALSKLANNQSAIVGVAGMTAALWIIAY------GKMSNKKRKPGYEDKIQYTIAEKKDKKAG 59
            ||.....|....|:|.|      ||...||      ...:|..|:.|....::   ..:||:|..
Zfish     1 MAAVSKYLTAGNSSIAG------ALLFAAYVLKQRLSTETNGYREKGSSKPLR---DNEKDRKTD 56

  Fly    60 KAHVNSVFFKQLRQLLPILIPGFWSVETGLLFLVAAALIGRSVSDIWMIQNATVVESTIIHMNRT 124
            ||.|::|||:::..:|.||:|..:..|:|.|.|:|..|:.|:..|:|||.|.|::||.||..:.|
Zfish    57 KAAVDNVFFRRICHILKILMPQAFCKESGYLLLIAVMLVARTYCDVWMIHNGTMIESAIIGRSTT 121

  Fly   125 KFKTALLKYLTALPAISVVTNVLKWSLGELKLRFRTNLTHHLYSQYLNGYTYYKMSNLDNRIANA 189
            .||..|:.::|.:|.||:|.|.||..:.||||.||..||:|||:.||.|:|||::.||||||||.
Zfish   122 TFKRYLVNFITVMPFISLVNNFLKLGINELKLCFRVRLTNHLYNDYLKGFTYYQIGNLDNRIANP 186

  Fly   190 DQLLTTDIDKFCESATDLYSNISKPVLDIFIYVYRLTVNLGGKTPSILMLYLLFAGVFLTRLRRP 254
            |||:|.|::|||.|..|||||:|||:|||.||:::|...:|...|:.|:.|||.:|:.|||||||
Zfish   187 DQLITQDVEKFCNSVVDLYSNVSKPLLDILIYIFKLNTAIGSLGPATLLGYLLLSGLLLTRLRRP 251

  Fly   255 TGRLTVEEQKLEGEFRYVNSRLITNSEEVAFYQGNVREKLTLLASYSKLRSHLRKFLEFRVSMGI 319
            .|::||.||:.|||:|||||||||||||:|||.||:|||.|::.::.||..||.:|:.||.|||:
Zfish   252 IGKMTVTEQRYEGEYRYVNSRLITNSEEIAFYNGNLREKQTIIGTFQKLVDHLSRFIHFRFSMGV 316

  Fly   320 IDNIIGKYFASIVGFYAVSIPFFSENHPLLSGENSGQRLQAYYTYGRMLVKLAEAIGRLVLAGRE 384
            :|:||.||.|..||:..:|.||...::.........:||:.||..||||:.||:|:||:||||||
Zfish   317 MDSIIAKYIAMAVGYLVISRPFLDISNQRHINSTYAERLEDYYQSGRMLMSLAQALGRIVLAGRE 381

  Fly   385 MSRLAGFTARMTELIKVLSDLNKGTYERTMVNGNNLAQNAVGSASSNFGPNKGIMCFEDNIIRFE 449
            |:||:|||||:||:.:||.:||.|.||||||. :.:...||....  ..|.:|.:...||.|:||
Zfish   382 MTRLSGFTARITEIQEVLKELNSGKYERTMVT-HRIKDTAVDKIP--LIPGRGEIIIADNKIKFE 443

  Fly   450 KVPLVTPNGDVLLQELSFEVKSGTNVLVCGPNGCGKSSLFRILGELWPTWGGKVTKPSRGKLFYV 514
            .:||.|||||:|:.:|||||.||||||||||||||||||||:||||||..|||:|||.|||||||
Zfish   444 HIPLATPNGDILISDLSFEVSSGTNVLVCGPNGCGKSSLFRVLGELWPLCGGKLTKPERGKLFYV 508

  Fly   515 PQRPYMTLGTLRDQIIYPHTRDDMRRLGHSDEDLMHYLDIVQLTYLEQRENGLDSIEDWIDVLSG 579
            |||||||||:||||:|||.|.:|..:...||..|..|||.|||.::.:||...:|::||:|||||
Zfish   509 PQRPYMTLGSLRDQVIYPDTLEDQMKKRTSDRVLKEYLDNVQLGHILEREGSWESVQDWMDVLSG 573

  Fly   580 GEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGKMYSYCREVGITLFTVSHRKSLWAHHDYYLQ 644
            |||||:|||||||||||||||||||||||||||..:||:||:|||||||||||||||.||:|||.
Zfish   574 GEKQRMAMARLFYHKPQFAILDECTSAVSVDVEDFIYSHCRKVGITLFTVSHRKSLWKHHEYYLH 638

  Fly   645 FDGRGSYEFATIDQDKDHFGS 665
            .||||:|||..|.::...|||
Zfish   639 MDGRGNYEFKPITKETVEFGS 659

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pmp70NP_001259732.1 3a01203 3..653 CDD:273360 366/656 (56%)
ABC_membrane_2 63..342 CDD:284003 150/279 (54%)
ABCD_peroxisomal_ALDP 446..651 CDD:213190 152/205 (74%)
abcd3bNP_001124092.1 3a01203 1..647 CDD:273360 368/658 (56%)
ABC_membrane_2 60..339 CDD:284003 150/279 (54%)
ABCD_peroxisomal_ALDP 440..645 CDD:213190 152/205 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56243242
eggNOG 1 0.900 E1_COG4178
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 758 1.000 Inparanoid score I526
OMA 1 1.010
OrthoDB 1 1.010 D146647at33208
OrthoFinder 1 1.000 FOG0000531
OrthoInspector 1 1.000 T597846
orthoMCL 1 0.900 OOG5_126726
Panther 1 1.100 O PTHR11384
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.