DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alr and ERV1

Sequence 1:NP_001259731.1 Gene:Alr FlyBaseID:FBgn0031068 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_011543.4 Gene:ERV1 SGDID:S000003261 Length:189 Species:Saccharomyces cerevisiae

Alignment Length:196 Identity:72/197 (37%)
Similarity:100/197 (51%) Gaps:29/197 (15%)


  Fly    82 MDKEHHESPFAANRKAGASGA-------GKQDSNCRTCNDFKSWSKQQRLISNVQSAKVKHMAAA 139
            :||.....|     :.|.||.       ||.   ||:||....:......|||    .:|::::.
Yeast     4 IDKMTDNPP-----QEGLSGRKIIYDEDGKP---CRSCNTLLDFQYVTGKISN----GLKNLSSN 56

  Fly   140 EKLT-----VNAAEDPLP-----RDDCPLDKVRLGISTWGLLHTMAAFYSDNPTDTEKRDMKTFF 194
            .||.     ...|.:.:|     |...|.|..:||.|:|.|||::||.|...|||.:|.:||.|.
Yeast    57 GKLAGTGALTGEASELMPGSRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFL 121

  Fly   195 EVLSRLYPCEFCAKDFRTDLDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNERWRDG 259
            .:.|.:|||.:|||||...:..|...|.|::||..|:|:.||:||.||.||.|||....:||:||
Yeast   122 NIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDG 186

  Fly   260 W 260
            |
Yeast   187 W 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AlrNP_001259731.1 Evr1_Alr 109..260 CDD:295176 63/161 (39%)
ERV1NP_011543.4 ERV1 4..189 CDD:227387 72/197 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258882991
eggNOG 1 0.900 E1_COG5054
Hieranoid 1 1.000
Homologene 1 1.000 H136648
Inparanoid 1 1.050 120 1.000 Inparanoid score I1295
Isobase 1 0.950 0 Normalized mean entropy S1026
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002493
OrthoInspector 1 1.000 T1135565
orthoMCL 1 0.900 OOG5_127535
Panther 1 1.100 LDO PTHR12645
Phylome 1 0.910 0.933 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R414
TreeFam 1 0.960
1312.730

Return to query results.
Submit another query.