DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alr and Erv1

Sequence 1:NP_001259731.1 Gene:Alr FlyBaseID:FBgn0031068 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_564557.1 Gene:Erv1 AraportID:AT1G49880 Length:191 Species:Arabidopsis thaliana

Alignment Length:147 Identity:58/148 (39%)
Similarity:82/148 (55%) Gaps:8/148 (5%)


  Fly   126 SNVQSAKVKHMAAAEKLTVNAAEDPLPRDD---CPLDKVRLGISTWGLLHTMAAFYSDNPTDTEK 187
            |.:|:..:...::....|.:::...||..|   .|:.|..||.:||..|||:||.|.:.||..:|
plant    39 STIQNPIISLDSSPPIATNSSSLQKLPLKDKSTGPVTKEDLGRATWTFLHTLAAQYPEKPTRQQK 103

  Fly   188 RDMKTFFEVLSRLYPCEFCAKDFRTDLDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKV 252
            :|:|....:|||:|||..||..|:..|..||....||:|.:.|||..||.||..|||.:|.|.:|
plant   104 KDVKELMTILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERV 168

  Fly   253 NERWRDGWLD---GSCD 266
            :.||  |.|:   .|||
plant   169 DARW--GKLECEQKSCD 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AlrNP_001259731.1 Evr1_Alr 109..260 CDD:295176 54/137 (39%)
Erv1NP_564557.1 Evr1_Alr 82..169 CDD:282612 41/87 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1537996at2759
OrthoInspector 1 1.000 T193451
orthoMCL 1 0.900 OOG5_127535
Panther 1 1.100 O PTHR12645
Phylome 1 0.910 0.667 Consistency score
65.920

Return to query results.
Submit another query.