DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alr and Gfer

Sequence 1:NP_001259731.1 Gene:Alr FlyBaseID:FBgn0031068 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_037354.2 Gene:Gfer RGDID:61845 Length:198 Species:Rattus norvegicus

Alignment Length:184 Identity:77/185 (42%)
Similarity:103/185 (56%) Gaps:34/185 (18%)


  Fly    92 AANRKAGASGA---------GKQDSNCRTCNDFKSWSKQQRLISNVQSAKVKHMAAAEKLTVNAA 147
            |.:||..|..|         ||:.  ||.|.|||||.:.|      |...:|.            
  Rat    40 ARHRKDNAPAAAPAPKGLEHGKRP--CRACVDFKSWMRTQ------QKRDIKF------------ 84

  Fly   148 EDPLPRDDCPLDKVRLGISTWGLLHTMAAFYSDNPTDTEKRDMKTFFEVLSRLYPCEFCAKDFRT 212
                 |:|||.|:..||.:||..|||:||:|.|.||..:::||..|..:.|:.||||.||:|.|.
  Rat    85 -----REDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRK 144

  Fly   213 DLDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNERWRDGWLDGSCD 266
            .:|.:..:.:::...:.|||:.||.||.|||||.|||::|:|||||||.|||||
  Rat   145 RIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AlrNP_001259731.1 Evr1_Alr 109..260 CDD:295176 64/151 (42%)
GferNP_037354.2 Evr1_Alr <79..194 CDD:295176 55/132 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258867365
eggNOG 1 0.900 E1_COG5054
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I4184
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1537996at2759
OrthoFinder 1 1.000 FOG0002493
OrthoInspector 1 1.000 T617481
orthoMCL 1 0.900 OOG5_127535
Panther 1 1.100 LDO PTHR12645
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1110.760

Return to query results.
Submit another query.