DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alr and GFER

Sequence 1:NP_001259731.1 Gene:Alr FlyBaseID:FBgn0031068 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_005253.3 Gene:GFER HGNCID:4236 Length:205 Species:Homo sapiens

Alignment Length:195 Identity:74/196 (38%)
Similarity:97/196 (49%) Gaps:48/196 (24%)


  Fly    97 AGASGAGKQDS-------------------------NCRTCNDFKSWSKQQRLISNVQSAKVKHM 136
            |...|||::|:                         .||.|.|||:|.:.|:             
Human    34 ARGRGAGRRDAAASASTPAQAPTSDSPVAEDASRRRPCRACVDFKTWMRTQQ------------- 85

  Fly   137 AAAEKLTVNAAEDPLPRDDCPLDKVRLGISTWGLLHTMAAFYSDNPTDTEKRDMKTFFEVLSRLY 201
                      ..|...|:|||.|:..||..:|.:|||:||:|.|.||..:::||..|..:.|:.|
Human    86 ----------KRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFY 140

  Fly   202 PCEFCAKDFRTDLDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNERWRDGWLDGSCD 266
            |||.||:|.|..|..|..:..::.....|||..||.||.|||||.|||:||:|||||||.|||||
Human   141 PCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD 205

  Fly   267  266
            Human   206  205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AlrNP_001259731.1 Evr1_Alr 109..260 CDD:295176 63/151 (42%)
GFERNP_005253.3 Evr1_Alr <86..201 CDD:295176 56/115 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258871333
eggNOG 1 0.900 E1_COG5054
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4365
Isobase 1 0.950 0 Normalized mean entropy S1026
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002493
OrthoInspector 1 1.000 T1072358
orthoMCL 1 0.900 OOG5_127535
Panther 1 1.100 LDO PTHR12645
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R414
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.730

Return to query results.
Submit another query.