DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alr and SPBC146.04

Sequence 1:NP_001259731.1 Gene:Alr FlyBaseID:FBgn0031068 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_595393.1 Gene:SPBC146.04 PomBaseID:SPBC146.04 Length:192 Species:Schizosaccharomyces pombe

Alignment Length:129 Identity:34/130 (26%)
Similarity:57/130 (44%) Gaps:20/130 (15%)


  Fly   128 VQSAKVKHMAAAEKLTVNAAEDPLPRDDCPLDKVRLGISTWGLLHTMAAFYSDNPTDTEKRDMKT 192
            ::....||......|.|||                    .|.|:||:.:.|.:.||..|:..::.
pombe    54 IEMMSTKHDNNTNNLMVNA--------------------YWKLIHTVVSNYPNRPTLDERDILRH 98

  Fly   193 FFEVLSRLYPCEFCAKDFRTDLDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNERW 256
            :....:...||...:.:.:..|||:|...:|:|....|.||.||::|:|:.:|...|...|||:
pombe    99 YLFSSAITMPCGEYSVELQKILDVHPPQTSSRKAATTWACKVHNQLNEKMNQPKTSCDGFNERY 162

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AlrNP_001259731.1 Evr1_Alr 109..260 CDD:295176 34/130 (26%)
SPBC146.04NP_595393.1 ERV1 1..168 CDD:227387 34/130 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002493
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127535
Panther 1 1.100 O PTHR12645
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.870

Return to query results.
Submit another query.