DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alr and F56C11.3

Sequence 1:NP_001259731.1 Gene:Alr FlyBaseID:FBgn0031068 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_490690.1 Gene:F56C11.3 WormBaseID:WBGene00018955 Length:161 Species:Caenorhabditis elegans

Alignment Length:164 Identity:71/165 (43%)
Similarity:96/165 (58%) Gaps:7/165 (4%)


  Fly   103 GKQDSNCRTCNDFKSWSKQQRLISNVQSAKVKHMAAAEKLTVNAAEDPLPRDDCPLDKVRLGIST 167
            |.....||.|...:...|:.|.::.    |:|   ..|..|..:.........||:||..||.||
 Worm     4 GPDGKPCRACVSVEDMMKKGREMAE----KIK---KKESETTPSTSTGAKLHGCPVDKDELGRST 61

  Fly   168 WGLLHTMAAFYSDNPTDTEKRDMKTFFEVLSRLYPCEFCAKDFRTDLDVNPINVNSQKELALWLC 232
            |.|||||:.:|.:.|||.:|...::|..:|.:.|||:|||||.|.||..:|..|.|::..|||:|
 Worm    62 WNLLHTMSVYYPEKPTDEDKDRARSFMSILGKTYPCDFCAKDLRKDLKESPPKVESREAFALWMC 126

  Fly   233 KFHNRVNDKLGKPLFDCTKVNERWRDGWLDGSCD 266
            :.||:||:|.|||.|:|..|.:||||||.|||||
 Worm   127 QLHNKVNEKTGKPKFECRDVMQRWRDGWKDGSCD 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AlrNP_001259731.1 Evr1_Alr 109..260 CDD:295176 64/151 (42%)
F56C11.3NP_490690.1 Evr1_Alr 60..148 CDD:282612 44/88 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258238959
eggNOG 1 0.900 E1_COG5054
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2903
Isobase 1 0.950 0 Normalized mean entropy S1026
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1537996at2759
OrthoFinder 1 1.000 FOG0002493
OrthoInspector 1 1.000 T475710
orthoMCL 1 0.900 OOG5_127535
Panther 1 1.100 LDO PTHR12645
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R414
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.