DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alr and Gfer

Sequence 1:NP_001259731.1 Gene:Alr FlyBaseID:FBgn0031068 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_075527.2 Gene:Gfer MGIID:107757 Length:198 Species:Mus musculus

Alignment Length:178 Identity:76/179 (42%)
Similarity:100/179 (56%) Gaps:26/179 (15%)


  Fly    89 SPFAANRKAGASGAGKQDSNCRTCNDFKSWSKQQRLISNVQSAKVKHMAAAEKLTVNAAEDPLPR 153
            :|.||....|.. .||:.  ||.|.|||||.:.|      |...:|.                 |
Mouse    47 TPAAAPAPQGLE-HGKRP--CRACVDFKSWMRTQ------QKRDIKF-----------------R 85

  Fly   154 DDCPLDKVRLGISTWGLLHTMAAFYSDNPTDTEKRDMKTFFEVLSRLYPCEFCAKDFRTDLDVNP 218
            :|||.|:..||..||..|||:||:|.|.||..:::||..|..:.|:.||||.||:|.|..:..|.
Mouse    86 EDCPQDREELGRHTWAFLHTLAAYYPDRPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIGRNQ 150

  Fly   219 INVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNERWRDGWLDGSCD 266
            .:.:::...:.|||:.||.||.|||||.|||::|:|||||||.|||||
Mouse   151 PDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AlrNP_001259731.1 Evr1_Alr 109..260 CDD:295176 64/151 (42%)
GferNP_075527.2 Evr1_Alr <79..194 CDD:295176 55/132 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258867814
eggNOG 1 0.900 E1_COG5054
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4308
Isobase 1 0.950 0 Normalized mean entropy S1026
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002493
OrthoInspector 1 1.000 T1082421
orthoMCL 1 0.900 OOG5_127535
Panther 1 1.100 LDO PTHR12645
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R414
TreeFam 1 0.960
1211.730

Return to query results.
Submit another query.