DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alr and LOC100912596

Sequence 1:NP_001259731.1 Gene:Alr FlyBaseID:FBgn0031068 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_003752247.2 Gene:LOC100912596 RGDID:6486432 Length:291 Species:Rattus norvegicus

Alignment Length:129 Identity:48/130 (37%)
Similarity:63/130 (48%) Gaps:34/130 (26%)


  Fly    92 AANRKAGASGA---------GKQDSNCRTCNDFKSWSKQQRLISNVQSAKVKHMAAAEKLTVNAA 147
            |.:||..|..|         ||:.  ||.|.|||||.:.|      |...:|.            
  Rat   186 ARHRKDNAPAAAPAPKGLEHGKRP--CRACVDFKSWMRTQ------QKRDIKF------------ 230

  Fly   148 EDPLPRDDCPLDKVRLGISTWGLLHTMAAFYSDNPTDTEKRDMKTFFEVLSRLYPCEFCAKDFR 211
                 |:|||.|:..||.:||..|||:||:|.|.||..:::||..|..:.|:.||||.||:|.|
  Rat   231 -----REDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIR 289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AlrNP_001259731.1 Evr1_Alr 109..260 CDD:295176 41/104 (39%)
LOC100912596XP_003752247.2 Evr1_Alr <225..>290 CDD:295176 31/83 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1537996at2759
OrthoFinder 1 1.000 FOG0002493
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.