DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alr and gfer

Sequence 1:NP_001259731.1 Gene:Alr FlyBaseID:FBgn0031068 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_002935903.1 Gene:gfer XenbaseID:XB-GENE-987617 Length:191 Species:Xenopus tropicalis

Alignment Length:183 Identity:80/184 (43%)
Similarity:112/184 (61%) Gaps:15/184 (8%)


  Fly    84 KEHHESPFAANRKAGASGAGKQDSNCRTCNDFKSWSKQQRLISNVQSAKVKHMAAAEKLTVNAAE 148
            |:..::..||....|.:.|.|:.  ||.|.|||||.:|||          :..||.::..:...|
 Frog    24 KQDGKAESAAVGGEGGTAAPKKP--CRACMDFKSWMRQQR----------RQGAAPQEAEIEDKE 76

  Fly   149 DPLPRDDCPLDKVRLGISTWGLLHTMAAFYSDNPTDTEKRDMKTFFEVLSRLYPCEFCAKDFRTD 213
            .|.   :||||:..||.|:|..||||||:|.|.||:.::::|::|..:.|:.|||:.||:|.|..
 Frog    77 RPA---ECPLDREELGRSSWSFLHTMAAYYPDQPTNQQQQEMRSFINLFSKFYPCDECAEDMRER 138

  Fly   214 LDVNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNERWRDGWLDGSCD 266
            ||....:.:|:..|:.|:|..||.||.||||..|||:||:|||||||.|||||
 Frog   139 LDSTQPDTSSRHNLSQWMCILHNDVNRKLGKEAFDCSKVDERWRDGWKDGSCD 191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AlrNP_001259731.1 Evr1_Alr 109..260 CDD:295176 68/151 (45%)
gferXP_002935903.1 Evr1_Alr 91..179 CDD:282612 41/88 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258877109
eggNOG 1 0.900 E1_COG5054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1537996at2759
OrthoFinder 1 1.000 FOG0002493
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.