DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubqn and Ubqln4

Sequence 1:NP_001285457.1 Gene:Ubqn FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_277068.1 Gene:Ubqln4 MGIID:2150152 Length:596 Species:Mus musculus

Alignment Length:615 Identity:291/616 (47%)
Similarity:393/616 (64%) Gaps:89/616 (14%)


  Fly     1 MAE--GGSKR--INVVVKTPKDKKTVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTD 61
            |||  |...|  |.|.|||||||:.:.:.:.:.:|:||..::::|:|:.:||||||||||:||.|
Mouse     1 MAEPSGAETRPQIRVTVKTPKDKEEIVICDQASVKEFKEEISRRFKAQQDQLVLIFAGKILKDGD 65

  Fly    62 TLQMHNIKDNLTVHLVIKAPTRNNE----------------QPARQPADVRQTPFG--------- 101
            ||..|.|||.||||||||.|.:..:                .|:..||.....|..         
Mouse    66 TLSQHGIKDGLTVHLVIKTPQKAQDPVTAAASPPSTPDSASAPSTTPASPAAAPVQPCSSGNTTS 130

  Fly   102 -----------------------LNQFGGLAGMEALGAGSNTFMDLQARMQNELLNNGDMLRSLM 143
                                   |:.|||:.|:.:||.||..||:||.:||.:|::|.:||..:|
Mouse   131 DAGSGGGPSPVAAEGPSSATASILSGFGGILGLGSLGLGSANFMELQQQMQRQLMSNPEMLSQIM 195

  Fly   144 DNPMVQQMMNNPDTMRQLITSNPQMHDLMQRNPEISHMLNNPDLLRQTMELARNPSMLQELMRSH 208
            :||:||.||:|||.||.:|.:||||..||:||||||||||||:|:||||||||||:|:||:||:.
Mouse   196 ENPLVQDMMSNPDLMRHMIMANPQMQQLMERNPEISHMLNNPELMRQTMELARNPAMMQEMMRNQ 260

  Fly   209 DRAMSNLESVPGGYSALQRIYRDIQEPMMNAATESFGRNPFAGLVDGGGSGAGNNPQQGTENRNP 273
            |||:||||||||||:||:|:|.||||||..||.|.||.|||:.|. |....:.:.|.: ||||.|
Mouse   261 DRALSNLESVPGGYNALRRMYTDIQEPMFTAAREQFGNNPFSSLA-GNSDNSSSQPLR-TENREP 323

  Fly   274 LPNPWG-------GANSGTNGTVGGSGAG--NPTGDLP--------PNNVLNTPAMRSLLQQMAD 321
            |||||.       ...||..|| ||||..  :||...|        .:.:.|:|.|::||||:::
Mouse   324 LPNPWSPSPPTSQAPGSGGEGT-GGSGTSQVHPTVSNPFGINAASLGSGMFNSPEMQALLQQISE 387

  Fly   322 NPAMMQNLLNAPYTRSMMESMSQDPDMAARLLSSSPLMSNNPALQEQVRQMMPQFMAQMQNPEVM 386
            ||.:|||:::|||.|:||::::|:||.||:::.:.||.:.||.||||:|..:|.|:.||||||.:
Mouse   388 NPQLMQNVISAPYMRTMMQTLAQNPDFAAQMMVNVPLFAGNPQLQEQLRLQLPVFLQQMQNPESL 452

  Fly   387 NMLTNPDAMNAILQIQQGMEQLRSAAPGLVGTLGIPPPPPGAGTGTNPASGDGSGGNSGASTNNV 451
            ::||||.||.|:||||||::.|::.|||||.:||        ..||...|...:|.|||:|....
Mouse   453 SILTNPRAMQALLQIQQGLQTLQTEAPGLVPSLG--------SFGTPRTSVPLAGSNSGSSAEAP 509

  Fly   452 SPSSGLNAGTGTPNLAPGGGPNAQLFNDFMMRMLNGMSNNADNTQP-PEVRYQSQLEQLNAMGFV 515
            :.|.|:.|.:     .|..|.|||  ...|.:|:..:|.:.::..| ||||:|.||||||:|||:
Mouse   510 TSSPGVPATS-----PPSAGSNAQ--QQLMQQMIQLLSGSGNSQVPMPEVRFQQQLEQLNSMGFI 567

  Fly   516 NRDANLQALIATFGDINAAVERLLSLNQLS 545
            ||:|||||||||.||||||:||||. :|||
Mouse   568 NREANLQALIATGGDINAAIERLLG-SQLS 596

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563 40/70 (57%)
hPLIC_N 9..79 CDD:176403 40/70 (57%)
STI1 322..368 CDD:128966 23/46 (50%)
UBA_PLICs 501..537 CDD:270582 29/36 (81%)
Ubqln4NP_277068.1 UBQ 13..83 CDD:214563 40/70 (57%)
hPLIC_N 13..83 CDD:176403 40/70 (57%)
STI1 187..224 CDD:128966 21/37 (57%)
UBA_PLICs 553..592 CDD:270582 32/39 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5272
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 531 1.000 Inparanoid score I1196
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000468
OrthoInspector 1 1.000 T616960
orthoMCL 1 0.900 OOG5_127163
Panther 1 1.100 LDO PTHR10677
Phylome 1 0.910 0.909 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2096
TreeFam 1 0.960
1110.860

Return to query results.
Submit another query.