DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubqn and DSK2

Sequence 1:NP_001285457.1 Gene:Ubqn FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_014003.1 Gene:DSK2 SGDID:S000004889 Length:373 Species:Saccharomyces cerevisiae

Alignment Length:578 Identity:137/579 (24%)
Similarity:196/579 (34%) Gaps:256/579 (44%)


  Fly     9 INVVVKTPKDKKTVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLT 73
            :|:.:|:.:||..|.|..:|.:..||..:.:..........||::|||:||..|::.::|:|..:
Yeast     3 LNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHS 67

  Fly    74 VHLVIKAPTRNNEQPARQPADVRQTPFGLNQ---FGGLAGMEAL-------GAGSNTFMDL-QAR 127
            ||||       ..||..|.|...    |.|.   .|..||..|.       .||.|...|| .||
Yeast    68 VHLV-------KSQPKPQTASAA----GANNATATGAAAGTGATPNMSSGQSAGFNPLADLTSAR 121

  Fly   128 MQ------------------NELLNNGDMLRSLMDNPMVQQMMN----NPDTMRQLITSNPQMHD 170
            ..                  |...||.|.|..:|:||:.|..||    ||..:..:|.||||:..
Yeast   122 YAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQSNPQLQA 186

  Fly   171 L------MQRNPEISHMLNNPDLLRQTMELARNPSMLQELMRSHDRAMSNLESVPGGYSALQRIY 229
            :      |.::|....||.|||::||:|:.||                                 
Yeast   187 MGPQARQMLQSPMFRQMLTNPDMIRQSMQFAR--------------------------------- 218

  Fly   230 RDIQEPMMNAATESFGRNPFAGLVDGGGSGA------GNNPQQGTENRNPLPNPWGGANSGTN-G 287
                  ||         :|.||:...||:.:      |:.|::|:..     |....:|:|.| |
Yeast   219 ------MM---------DPNAGMGSAGGAASAFPAPGGDAPEEGSNT-----NTTSSSNTGNNAG 263

  Fly   288 TVGGSGAGNPTGDLPPNNVLNTPAMRSLLQQMADNPAMMQNLLNAPYTRSMMESMSQDPDMAARL 352
            |..|:.||           .||.|          ||                         .|.|
Yeast   264 TNAGTNAG-----------ANTAA----------NP-------------------------FASL 282

  Fly   353 LSSSPLMSNNPALQEQVRQMMPQFMAQMQNPEVMNMLTNPDAMNAILQIQQGMEQLRSAAPGLVG 417
            |        ||||                         ||.|                       
Yeast   283 L--------NPAL-------------------------NPFA----------------------- 291

  Fly   418 TLGIPPPPPGAGTGTNPASGDGSGGNSGASTNNVSPSSGLNAGTGTPNLAPGGGPNAQLFNDFMM 482
                                  :.||:              |.||.|...|     |.|.:.|..
Yeast   292 ----------------------NAGNA--------------ASTGMPAFDP-----ALLASMFQP 315

  Fly   483 RMLNGMSNNADNTQPPEVRYQSQLEQLNAMGFVNRDANLQALIATFGDINAAVERLLS 540
            .:   .::.|::|:|||.||:.||.|||.|||.:.|.|:.||..:.|.:..|::.||:
Yeast   316 PV---QASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLN 370

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563 23/70 (33%)
hPLIC_N 9..79 CDD:176403 23/70 (33%)
STI1 322..368 CDD:128966 9/46 (20%)
UBA_PLICs 501..537 CDD:270582 16/36 (44%)
DSK2NP_014003.1 Scythe_N 3..73 CDD:176404 23/77 (30%)
STI1 149..185 CDD:128966 15/36 (42%)
UBA_Dsk2p_like 328..369 CDD:270509 19/41 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000468
OrthoInspector 1 1.000 T1136750
orthoMCL 1 0.900 OOG5_127163
Panther 1 1.100 LDO PTHR10677
Phylome 1 0.910 0.955 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2096
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.