DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubqn and CG3223

Sequence 1:NP_001285457.1 Gene:Ubqn FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_649758.1 Gene:CG3223 FlyBaseID:FBgn0037538 Length:415 Species:Drosophila melanogaster

Alignment Length:545 Identity:107/546 (20%)
Similarity:182/546 (33%) Gaps:176/546 (32%)


  Fly    24 VDEDSGIKDFKILVAQK--FEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTVHLVIKAPTRNNE 86
            :|....:...|.:|.::  .:.:..:|.:|..|::::|.|||. ..::.|..:|...|.   ...
  Fly    21 IDLTRDVAYLKAVVTKEMHLQFDASELEIIHHGRVLEDADTLN-RTLQPNAVIHCFQKI---KRY 81

  Fly    87 QPARQPADVRQTPFGLNQFGGLAGMEALGAGS--NTFMDLQARMQNELLNNGDMLRSLMDNPMVQ 149
            .|...||........:.:...|.....:...|  |....:.|.......|.|  .::|:.:.::.
  Fly    82 SPYVPPAAAEINTKHIQELFSLTSHLQISVTSRFNILQKILAEYPEFRRNLG--AQALIRDSVLF 144

  Fly   150 QMMNNPDTMRQLITSNPQMHDLMQRNPEISHMLNNPDLLRQTMELARNPSMLQELMRSHDRAMSN 214
            .|::.|:.::.|:...|.   :.:..|.|      .|.:|:  |||||.|..|            
  Fly   145 NMLHEPEVVQNLVKDYPL---ICEAAPFI------VDTIRK--ELARNSSATQ------------ 186

  Fly   215 LESVPGGYSALQRIYRDIQEPMMNAATESFGRNPFAGLVDGGGSGAGNNPQQGTENRNPLPNPWG 279
                             :||   .||:||                     ...:|..|.|     
  Fly   187 -----------------LQE---QAASES---------------------TTSSEEENSL----- 205

  Fly   280 GANSGTNGTVGGSGAGNPTGDLPPNNVLNTPAMRSLLQQMADNPAMMQNLLNAPYTRSMMESMSQ 344
            ||.|.::   |||                                                  |.
  Fly   206 GAGSSSS---GGS--------------------------------------------------SS 217

  Fly   345 DPDMAARLLSSSPLMSNNPALQEQVRQMMPQFMAQ-MQNPEVMNMLTNPDAMNAILQIQQGMEQL 408
            ....||...:....|:|       :||:..|.:|. :.|....|.|:|....||. :..||.|:.
  Fly   218 TAVAAAAAANRRDEMAN-------IRQISRQQLANALANVTPFNSLSNIAQRNAD-EAVQGDERP 274

  Fly   409 RSAAPGLVGTLGIPPPPPGAGTGTNPASGDGSGGNSGA-STNNVSPS----------SGLNAGTG 462
            |:.:..|.|..|              |:|.|:|.:||| |:.::|..          ..|:....
  Fly   275 RTTSAPLAGVGG--------------AAGTGAGSSSGAISSGSISSELLRNELARAFQSLSQDQP 325

  Fly   463 TP----NLAPGGGPNAQLFNDFMMRMLNGMSNNADNTQPPEVRYQ-----SQLEQLNAMGFVNRD 518
            .|    .:..|.||..:.........::...:..|::.....||:     .||..:.||||:|..
  Fly   326 APVENMEVESGEGPVPEQAATAPADDVDDEDDGGDDSDVLPRRYRRHRFTEQLRTMAAMGFINHT 390

  Fly   519 ANLQALIATFGDINAAVERL-LSLN 542
            .|:..|..:.|::..|:..| ||:|
  Fly   391 QNVSYLELSDGNVEHAINLLMLSMN 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563 12/57 (21%)
hPLIC_N 9..79 CDD:176403 12/57 (21%)
STI1 322..368 CDD:128966 5/46 (11%)
UBA_PLICs 501..537 CDD:270582 13/41 (32%)
CG3223NP_649758.1 UBA_like_SF 373..410 CDD:304366 11/37 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10677
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.