DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubqn and ubqln4

Sequence 1:NP_001285457.1 Gene:Ubqn FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_998521.2 Gene:ubqln4 ZFINID:ZDB-GENE-030131-6269 Length:599 Species:Danio rerio

Alignment Length:586 Identity:282/587 (48%)
Similarity:383/587 (65%) Gaps:72/587 (12%)


  Fly     9 INVVVKTPKDKKTVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLT 73
            |.|.|||||||:.:.:.||:.:..||..::::|:|:.:||||||||||:||.|||..|.|||.||
Zfish    26 IKVTVKTPKDKEEIAIAEDASVAQFKEEISKRFKAKQDQLVLIFAGKILKDGDTLGQHGIKDGLT 90

  Fly    74 VHLVIKAPTRNNEQPARQ---------------------PADVRQTPFG-------------LNQ 104
            ||||||...:.:...:.|                     ||....||.|             |..
Zfish    91 VHLVIKTAQKTSGAGSSQTSASSGPGPSQGSPSGTDTPSPAGNLGTPQGSGPSPTPSQPANILAG 155

  Fly   105 FGGLAGMEALGAGSNTFMDLQARMQNELLNNGDMLRSLMDNPMVQQMMNNPDTMRQLITSNPQMH 169
            ||.|:|:..||.||..||:||.:||.:|::|.:||..:|:||:||.||:|||.|||:|.:||||.
Zfish   156 FGDLSGLSNLGMGSANFMELQQQMQRQLMSNPEMLSQIMENPLVQSMMSNPDLMRQMIMANPQMQ 220

  Fly   170 DLMQRNPEISHMLNNPDLLRQTMELARNPSMLQELMRSHDRAMSNLESVPGGYSALQRIYRDIQE 234
            .||:||||||||||||:|:||||||||||:|:||:||:.|||:|||||:||||:||:|:|.||||
Zfish   221 QLMERNPEISHMLNNPELMRQTMELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQE 285

  Fly   235 PMMNAATESFGRNPFAGLVDGGGSGAGNNPQQGTENRNPLPNPWGGANSGTNGTVGGSGAGNP-- 297
            ||.:||.|.||.|||:.| .|.|...|..|.: ||||.|||||||    ..:||...:.:|.|  
Zfish   286 PMFSAAREQFGNNPFSAL-GGNGENPGTQPSR-TENREPLPNPWG----PPDGTASTTSSGTPTT 344

  Fly   298 ----TGDLPP--------------NNVLNTPAMRSLLQQMADNPAMMQNLLNAPYTRSMMESMSQ 344
                |....|              |.:.|:|.|:||:||:::||.:|||:::|||.|:||:|::|
Zfish   345 TSSTTSSTTPSVSNPLGISSSNLGNGMFNSPGMQSLMQQISENPQLMQNMISAPYMRTMMQSLAQ 409

  Fly   345 DPDMAARLLSSSPLMSNNPALQEQVRQMMPQFMAQMQNPEVMNMLTNPDAMNAILQIQQGMEQLR 409
            :||:|:::|.::||.:.||.||||:||.:|.|:.||||||.::::|||.||.|::|||:|::.|:
Zfish   410 NPDVASQVLMNNPLFAGNPQLQEQMRQQLPVFLQQMQNPEALSVMTNPRAMRALMQIQEGLQTLQ 474

  Fly   410 SAAPGLVGTLGIPPPPPGAGTGTNPASGDGSGGNSGASTNNVSPSSGLNAGTG-TPNLAPGGGPN 473
            :.||||:..||     ||...|..|....|:...:|.:   |:|.:...:|.| ||....|..|.
Zfish   475 TEAPGLMPGLG-----PGGMPGGIPVGMPGAPLPTGVT---VTPENPPPSGQGSTPTPTAGASPA 531

  Fly   474 AQLFNDFMMRMLNGMSNNADNTQPPEVRYQSQLEQLNAMGFVNRDANLQALIATFGDINAAVERL 538
            .|   ..|.:||...:..:.:||.||||:|.|||||:||||:||:|||||||||.||||||:|||
Zfish   532 QQ---QLMQQMLQMFAGGSASTQTPEVRFQQQLEQLSAMGFINREANLQALIATGGDINAAIERL 593

  Fly   539 L 539
            |
Zfish   594 L 594

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563 41/70 (59%)
hPLIC_N 9..79 CDD:176403 41/70 (59%)
STI1 322..368 CDD:128966 24/46 (52%)
UBA_PLICs 501..537 CDD:270582 29/36 (81%)
ubqln4NP_998521.2 UBQ 26..96 CDD:214563 41/70 (59%)
hPLIC_N 26..96 CDD:176403 41/70 (59%)
STI1 186..223 CDD:128966 22/37 (59%)
UBA_PLICs 556..595 CDD:270582 32/40 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1553668at2759
OrthoFinder 1 1.000 FOG0000468
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127163
Panther 1 1.100 LDO PTHR10677
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.