DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Naa20A and Naa20B

Sequence 1:NP_001259714.1 Gene:Naa20A FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001285885.1 Gene:Naa20B FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster

Alignment Length:170 Identity:69/171 (40%)
Similarity:110/171 (64%) Gaps:13/171 (8%)


  Fly     1 MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMG-KVEGH 64
            ||:.|.|..:|||||||:..|||.|.|.|.|....:.:.||....|::|...:||:|:| :||..
  Fly     1 MTSPRLFVLEDLFKFNNIVMDPLAEVYSLPFLLPKILEHPELVLAADAPDNSLMGFILGTRVEDA 65

  Fly    65 LDN--------W-HGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINM 120
            .::        | |||::||.|:.|||:|||...|::.:.|:.::::.:::|||||:.|.:||.:
  Fly    66 TESFGDAKTMTWNHGHISALAVAQDYRKLGLGTRLLTTVRDMMDRQKDFYIDLFVREKNTIAIGL 130

  Fly   121 YTNLGYIIYRTILEYYSGDQDEDAYDMRKALSRDVNKKSV 160
            |.:|||:.||.|.::|:   |:..|:||..||.||::||:
  Fly   131 YESLGYVKYRWIPKFYA---DDHGYEMRLPLSSDVDRKSL 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 63/160 (39%)
Acetyltransf_1 51..126 CDD:278980 32/85 (38%)
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 48/134 (36%)
Acetyltransf_1 50..137 CDD:278980 33/87 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244616102
eggNOG 1 0.900 E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S635
OrthoDB 1 1.010 D1355894at2759
OrthoFinder 1 1.000 FOG0002826
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45910
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.