DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Naa20A and CG31730

Sequence 1:NP_001259714.1 Gene:Naa20A FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_723799.1 Gene:CG31730 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster

Alignment Length:158 Identity:73/159 (46%)
Similarity:104/159 (65%) Gaps:6/159 (4%)


  Fly     1 MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQ--LAESPSGQIMGYIMG--KV 61
            ||:.|....|||||.|::.||.|||.|.|:|:.::..::|...|  :|..|.|:.||||.|  :|
  Fly     1 MTSFREMRFDDLFKINSLVFDALTEVYSLTFFVKHFLEFPGLSQIAIAPGPDGRPMGYIFGQYQV 65

  Fly    62 EGHLDNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGY 126
            :.:.|. :|||.||||||:|||||||..||.|...:|:.|.|.:|:||:|.||:.|..:||:|||
  Fly    66 KRNQDP-YGHVAALTVSPEYRRLGLATALMDFFFMVSDLKGASYVNLFMRISNRAAYQLYTSLGY 129

  Fly   127 IIYRTILEYYSGD-QDEDAYDMRKALSR 153
            ...:|.|:||..: :.|.||::||.:.|
  Fly   130 AHRQTFLDYYPDEPKPESAYELRKYVPR 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 72/155 (46%)
Acetyltransf_1 51..126 CDD:278980 41/77 (53%)
CG31730NP_723799.1 rimI 9..141 CDD:273701 64/133 (48%)
Acetyltransf_1 52..129 CDD:278980 41/78 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244620373
eggNOG 1 0.900 E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1355894at2759
OrthoFinder 1 1.000 FOG0002826
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45910
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.