DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and HSP17.6II

DIOPT Version :10

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_196763.1 Gene:HSP17.6II / 831075 AraportID:AT5G12020 Length:155 Species:Arabidopsis thaliana


Alignment Length:68 Identity:20/68 - (29%)
Similarity:34/68 - (50%) Gaps:11/68 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 EEIVVKTVDQKLLV-----HAKHEEKSDTKSVYRE-----YNREFLLPKGVNPESIRSSLSKDGV 170
            :||.|:..:..:||     ..:::|....|.|..|     :.|:|.||:..:.:.| |::..|||
plant    68 DEIKVQVENDNVLVVSGERQRENKENEGVKYVRMERRMGKFMRKFQLPENADLDKI-SAVCHDGV 131

  Fly   171 LTV 173
            |.|
plant   132 LKV 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 20/68 (29%)
HSP17.6IINP_196763.1 HSP20 48..136 CDD:459629 20/68 (29%)

Return to query results.
Submit another query.