DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and Hsp23

DIOPT Version :10

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster


Alignment Length:71 Identity:30/71 - (42%)
Similarity:41/71 - (57%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKS-VYREYNREFLLPKGVNPESIRSSLSKDGVLT 172
            |||.:.|.|:|||..|..:||...|||:.|... :.|.:.|.:.||.|...:.:.|:||.|||||
  Fly    76 DVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLT 140

  Fly   173 VDAPLP 178
            :..|.|
  Fly   141 IKVPKP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 28/68 (41%)
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 28/68 (41%)

Return to query results.
Submit another query.