DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and Hspb2

DIOPT Version :10

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_569115.1 Gene:Hspb2 / 161476 RGDID:70914 Length:182 Species:Rattus norvegicus


Alignment Length:69 Identity:30/69 - (43%)
Similarity:47/69 - (68%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKS-VYREYNREFLLPKGVNPESIRSSLSKDGVLT 172
            |||.:.|:|:.|:|||..|.|.|:|.::.|... |.||:.|.::||..|:|..:|::||.||:|.
  Rat    79 DVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILN 143

  Fly   173 VDAP 176
            ::||
  Rat   144 LEAP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 30/69 (43%)
Hspb2NP_569115.1 Crystallin <21..55 CDD:425732
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 67..148 CDD:469641 30/69 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.