DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: car and Slh

Sequence 1:NP_001259707.1 Gene:car FlyBaseID:FBgn0000257 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001137769.2 Gene:Slh FlyBaseID:FBgn0264978 Length:639 Species:Drosophila melanogaster

Alignment Length:690 Identity:133/691 (19%)
Similarity:246/691 (36%) Gaps:198/691 (29%)


  Fly    36 KVIVLD---ETMIGPLDLVTRPKLFADRGIRLLALKPELHLPRE-VANV--VYVMRPRVALMEQL 94
            |:::.|   :.:|.|:..:   |...:.|:   .|..:||..|: :.:|  :|...|....::::
  Fly    33 KILIYDRVGQDIISPIISI---KELRELGV---TLHVQLHSDRDSIPDVPAIYFCLPTDENLDRI 91

  Fly    95 AAHVKAGGRAAAGRQYHILF-APRRSCLCVSQLE-------VSGVLGSFGNIEELAWNYLPLDVD 151
            .....:|    ....||:.| ||    :..|::|       .:|.:.:...:.:...|::.|:.|
  Fly    92 QQDFSSG----LYDVYHLNFLAP----ITRSKIENLAAAALHAGCVANIHRVYDQYVNFISLEDD 148

  Fly   152 LVSM--------------------EMPNAFRDVSVDGDTSSLYQAAVGLVQLQRLYGRIPKI--- 193
            ...:                    |...|..|..||    ||:...|.|       |.:|.|   
  Fly   149 FFILKHQQSDQLSYYAINRANTRDEEMEALMDSIVD----SLFALFVTL-------GNVPIIRCP 202

  Fly   194 -YGKGEFAHR---------VWEHAKQLGRDERTLYNGDKGVVD----QLILLDRSIDLLSPLATQ 244
             ....|...|         :|:....|...:.|...|  ||..    .|:||||::||.:||...
  Fly   203 RNSAAEMVARKLEKKLRENLWDARANLFHMDATQAGG--GVFSFQRPVLLLLDRNMDLATPLHHT 265

  Fly   245 LTYEGLIDEFYGIRQNKLTLPAENFPSDGALPGGGGSGPRVEESQSLLGDTEKKTILLHSG---- 305
            .:|:.|:.:...:..|.:      :..|.....|....|:..:.     |...:..:.|.|    
  Fly   266 WSYQALVHDVLDLGLNLV------YVEDETASAGARKKPKACDL-----DRNDRFWMTHKGSPFP 319

  Fly   306 ---EQLYAEL---RNKHFNEVTKLLARKAREIHVQMHATSQDKSVQEIKSFVENLLPQLMAQKKA 364
               |.:..||   ||.. .|:.:|......|....:..:..:.:...:.:.| |.|||||.:|:.
  Fly   320 TVAEAIQEELESYRNSE-EEIKRLKTSMGIEGESDIAFSLVNDTTARLTNAV-NSLPQLMEKKRL 382

  Fly   365 TSEHTAIAGLLHEQVNAVRFADDLAAEQEFMVCADIDKPSAYIEDLI--------ACRVELNRVL 421
            ...||.||..:...:.|.|.......|::.|....:|:|   :.||:        ..::.| .::
  Fly   383 IDMHTKIATAILNFIKARRLDSFFEIEEKVMSKQTLDRP---LLDLLRDGEFGQAEDKLRL-YII 443

  Fly   422 RLICMQCHAASGFKEKLLNHYKRELVHVYGLEVLLTISNLEK-SGLLHLQTESRAYSVLRKTLH- 484
            ..||.| ......:|:|     :|.:...|.: |..::.::: .|::     :|:.|:.:.|.: 
  Fly   444 YFICAQ-QLPESEQERL-----KEALQAAGCD-LTALAYVQRWKGIM-----NRSPSISQATQYE 496

  Fly   485 ----LTVDDNVEIEPKDISYVHSFYAPLTARIVEHSLKPLGWQTLKSQINNLPGPTFEDFQAQLV 545
                .||....::..:..|:|..                 |.:.|..:.:|||            
  Fly   497 GGGTKTVSMFTKLVSQGSSFVME-----------------GVKNLVVKRHNLP------------ 532

  Fly   546 GIGGRHTVTTVSE------------------------GSLLNVPRV----VLVCFVGGCTFAEIA 582
                   ||.::|                        |.:|...|.    .:|..|||..:.|..
  Fly   533 -------VTKITEQVMECRSNAETDDYLYLDPKLLKGGEVLPKNRAPFQDAVVFMVGGGNYIEYQ 590

  Fly   583 AL-RFLAAQEDNNVE--FLIATTKVVNKHSFLDSLMSSXG 619
            .| .|:..::.:||:  .:...:.:.|...||..|.:. |
  Fly   591 NLVDFIKQKQTSNVQRRIIYGASTLTNARQFLKELSALGG 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
carNP_001259707.1 Sec1 36..606 CDD:279352 128/676 (19%)
SlhNP_001137769.2 Sec1 1..630 CDD:301618 132/689 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C90551468
eggNOG 1 0.900 E1_COG5158
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11679
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.