DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ND-18 and ndufs4

Sequence 1:NP_573385.1 Gene:ND-18 FlyBaseID:FBgn0031021 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001018512.1 Gene:ndufs4 ZFINID:ZDB-GENE-050522-421 Length:168 Species:Danio rerio

Alignment Length:124 Identity:69/125 (55%)
Similarity:93/125 (74%) Gaps:1/125 (1%)


  Fly    60 ITVPTAVNLSPISGVPEEHIRERRVRIHIPPKNAMQSGTDNVNTWQIEFDNRERWENPLMGWASS 124
            |||...:::|.::|||||||:.|:|||.:|.:||||||..|.:.|:|:||.|||||||||||:|:
Zfish    46 ITVDEKLDISTLTGVPEEHIKTRKVRIFVPARNAMQSGVKNTHKWKIDFDTRERWENPLMGWSST 110

  Fly   125 GDPLSNMNVQFGSPEEAITFCERNGWRWYVDGAAKPKKERVKNYGINFAWNKRTRVSTK 183
            .||||||.:.|.:.|:||.|.|:|||.:.:.....| |.|||:||.||:|::|||.|.|
Zfish   111 ADPLSNMVLTFSTKEDAIAFAEKNGWSYDITEKRVP-KPRVKSYGANFSWDRRTRRSAK 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ND-18NP_573385.1 ETC_C1_NDUFA4 83..175 CDD:282634 52/92 (57%)
ndufs4NP_001018512.1 ETC_C1_NDUFA4 69..160 CDD:282634 52/92 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C228686686
eggNOG 1 0.900 E1_KOG3389
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I4241
OMA 1 1.010
OrthoDB 1 1.010 D1507807at2759
OrthoFinder 1 1.000 FOG0006361
OrthoInspector 1 1.000 T1054299
orthoMCL 1 0.900 OOG5_129903
Panther 1 1.100 LDO PTHR12219
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4298
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.