DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ND-18 and ndufs4

Sequence 1:NP_573385.1 Gene:ND-18 FlyBaseID:FBgn0031021 Length:183 Species:Drosophila melanogaster
Sequence 2:XP_002941075.1 Gene:ndufs4 XenbaseID:XB-GENE-947419 Length:169 Species:Xenopus tropicalis

Alignment Length:182 Identity:87/183 (48%)
Similarity:114/183 (62%) Gaps:21/183 (11%)


  Fly     3 ALRQVMCRSTASLQLYQANRA-AAARWASTATDGGPLDPKTALARPEELEQRNKLSGKITVPTAV 66
            ||||::..|.....:..:||: :.:.|....|.          |:..:|         |||...:
 Frog     8 ALRQLLWGSRTVGAVINSNRSLSTSTWRLAQTQ----------AQDTQL---------ITVDEKM 53

  Fly    67 NLSPISGVPEEHIRERRVRIHIPPKNAMQSGTDNVNTWQIEFDNRERWENPLMGWASSGDPLSNM 131
            ::|.|||||||||:.|:|.|.:|.:||||||..|...|:||||.|||||||||||||:.||||||
 Frog    54 DISTISGVPEEHIKTRKVHIFVPARNAMQSGVQNTKRWKIEFDTRERWENPLMGWASTADPLSNM 118

  Fly   132 NVQFGSPEEAITFCERNGWRWYVDGAAKPKKERVKNYGINFAWNKRTRVSTK 183
            .:.|.|.|:||:|.|:|||.:.|:....| |.:.|:||.||:||||||||||
 Frog   119 LLSFSSKEDAISFAEKNGWSYEVEEKRIP-KPKSKSYGANFSWNKRTRVSTK 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ND-18NP_573385.1 ETC_C1_NDUFA4 83..175 CDD:282634 53/92 (58%)
ndufs4XP_002941075.1 ETC_C1_NDUFA4 70..161 CDD:282634 53/92 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C228684332
eggNOG 1 0.900 E1_KOG3389
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4010
OMA 1 1.010
OrthoDB 1 1.010 D1507807at2759
OrthoFinder 1 1.000 FOG0006361
OrthoInspector 1 1.000 T1061096
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4298
TreeFam 1 0.960
1110.800

Return to query results.
Submit another query.