DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and Slc16a11

DIOPT Version :10

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_038941393.1 Gene:Slc16a11 / 287450 RGDID:1311125 Length:593 Species:Rattus norvegicus


Alignment Length:218 Identity:63/218 - (28%)
Similarity:98/218 - (44%) Gaps:16/218 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PDGGWGWVACFGVSLVNLATRSIEPSFGLLFGDTLKELNVGTTGAAVIISALDVCMNFSGLFVGP 75
            ||||||||.......||..:..:..|.||...|..:.........| .:|||.:.:..:...||.
  Rat   155 PDGGWGWVVAAAAFAVNGLSYGLLRSLGLALPDLAEHFERSAQDTA-WVSALALAVQQAASPVGS 218

  Fly    76 LLK-EFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVINGIGVGLSTSAAFVALNHYFKHK 139
            .|. .:..|.|.:.|.:|..|||..::.|.|:.|:.....::.|.|..|..:.|...|:.||..:
  Rat   219 ALSTRWGARPVVMVGGVLTSLGLVFSAFARSLLHLYLGLGLLAGSGWALVFAPALGTLSRYFSRR 283

  Fly   140 RGQAVGLSMAGTAMGMLIMPQLVRILLEAYDFRGAVLLLAGVALNATVGSVLLQPVKWHMKEEFD 204
            |..||||::.|.....|::...::.||:.:.:|||:|||..|.|:.|....||:|          
  Rat   284 RVLAVGLALTGNGASSLLLAPALQFLLDTFGWRGALLLLGAVTLHLTPCGALLRP---------- 338

  Fly   205 DEELMCISALPTPQPQLTVGGAG 227
                :.:|..|...|:..:...|
  Rat   339 ----LALSGDPLAPPRTPLAALG 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 16..>193 CDD:475125 52/177 (29%)
MFS <428..609 CDD:475125
Slc16a11XP_038941393.1 PHA03378 <42..158 CDD:223065 2/2 (100%)
MFS_MCT11_13 160..549 CDD:340981 58/213 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.