DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8034 and SLC16A13

DIOPT Version :10

Sequence 1:NP_573376.2 Gene:CG8034 / 32924 FlyBaseID:FBgn0031011 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_963860.1 Gene:SLC16A13 / 201232 HGNCID:31037 Length:426 Species:Homo sapiens


Alignment Length:219 Identity:61/219 - (27%)
Similarity:103/219 - (47%) Gaps:17/219 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RKVAPDGGWGWVACFGVSLVNLATRSIEPSFGLLFGDTLKELNVGTTGAAVI--ISALDVCMNFS 69
            |...||||||||........:.....:..|||:.|.:.:....   ..||.:  |:::.:.:...
Human     4 RTEPPDGGWGWVVVLSAFFQSALVFGVLRSFGVFFVEFVAAFE---EQAARVSWIASIGIAVQQF 65

  Fly    70 GLFVGPLLK-EFSYRKVAIAGSLLCGLGLALTSPATSMAHILSTYSVINGIGVGLSTSAAFVALN 133
            |..||..|. :|..|.|.:.|.:|..||:.|.|.|||:.|:..:..:::|.|..|:.:.....|:
Human    66 GSPVGSALSTKFGPRPVVMTGGILAALGMLLASFATSLTHLYLSIGLLSGSGWALTFAPTLACLS 130

  Fly   134 HYFKHKRGQAVGLSMAGTAMGMLIMPQLVRILLEAYDFRGAVLLLAGVALNATVGSVLLQPVKWH 198
            .||..:|..|.||::.|..:.........:.||..|.:||::||::.::|:......||:|..  
Human   131 CYFSRRRSLATGLALTGVGLSSFTFAPFFQWLLSHYAWRGSLLLVSALSLHLVACGALLRPPS-- 193

  Fly   199 MKEEFDDEELMCISALPTPQPQLT 222
            :.|:         .|:..|:.|||
Human   194 LAED---------PAVGGPRAQLT 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8034NP_573376.2 MFS 16..>193 CDD:475125 47/179 (26%)
MFS <428..609 CDD:475125
SLC16A13NP_963860.1 MFS_MCT11_13 13..392 CDD:340981 55/210 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.