DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rictor and rictorb

Sequence 1:NP_573371.1 Gene:rictor FlyBaseID:FBgn0031006 Length:1936 Species:Drosophila melanogaster
Sequence 2:XP_009293661.1 Gene:rictorb ZFINID:ZDB-GENE-070810-5 Length:1748 Species:Danio rerio

Alignment Length:1867 Identity:531/1868 (28%)
Similarity:834/1868 (45%) Gaps:386/1868 (21%)


  Fly    18 LRIKVSQDP-EDFYRLDPQRSAAENAFEIYSMLCLEETRDTKRLF--LLNALASLCLGARKGSHH 79
            :|::...|. |:...||..|..:||..||...:..::.....|..  |.|.:..||   ..|...
Zfish    18 IRMRGRNDSGEENVPLDLTREPSENMREILQNVAKQQGVSNMRKLGHLNNFIKLLC---NVGHSE 79

  Fly    80 SNIRFTTEELLYCLSASLVHTFTQVRAAALRTIRYAISTPNDIKTFNALQLQHLLCRSIDLMLKN 144
            ....||.||::.||..:|::...:||||.||::||.|...|.::....||:.:|:.|.||:...|
Zfish    80 EKFGFTYEEIIICLRLALLNEAKEVRAAGLRSLRYLIRDSNILQKVLRLQVDYLISRCIDIQQSN 144

  Fly   145 DDERVQALKLVRKMLAIAPEDISPAVVRCLVSLADSGIEENDNLLRACLATLAEFAVLNPALLIV 209
            :.||.|||:|||||:.:.......:|...|:::.:.|.:|.|.::|||:|.:.|.|:.||.::..
Zfish   145 EVERTQALRLVRKMITVNALLFPSSVANSLIAVGNDGPQERDRMVRACIAIICELALENPEIVAK 209

  Fly   210 CGGVTSITRNVLECHNPRIAESLCGVLLYLLEWPQTRNI--CGVRLDCLAAPYCDFTYR---QSI 269
            .||:::|.:||::|...||.|:|...:|:||..|.||..  ..|.|:.:.|||.||.||   .:.
Zfish   210 RGGLSTILKNVIDCQLSRINEALMTTILHLLNHPHTRQYVRSDVELEQILAPYTDFHYRHNPDTA 274

  Fly   270 VDKNKDARELRYTSCRLALLSVLRSWTGTLEFCDPSKPSGLKAIVDALYLNQIEVRKAILDLLYE 334
            ..:.|:.||.|:.:.::::::.||||:|.:..| .|..||:::::..|.:..:|||:.:|:::||
Zfish   275 EGQLKEDREARFLASKMSIVASLRSWSGIINLC-KSGNSGIQSLIGLLCIPNMEVRRGLLEVMYE 338

  Fly   335 LLTLPQPTWTDDYAVALQAVDPSDFQDTWLLSNGFVSAEGRSILPTLAARAPSVVEQHLALMLYC 399
            :..||.|..|.|:..||.:||||.|||:|.||:|||::|.:.|||..|...|.:::.:|||:|..
Zfish   339 IFRLPVPVVTQDFVEALLSVDPSRFQDSWRLSDGFVASEAKIILPHRARSRPDLMDNYLALLLSA 403

  Fly   400 FLETGLLNALVEVVVSSDQFVSVQATVLIGKILQLMHTHLPPDICCTSPALPTLVSHAT-----L 459
            |:.:|||..||||:.||:..|||:||:|:|::|.:.:|.||.........||||::.|.     .
Zfish   404 FIHSGLLEGLVEVITSSEDSVSVRATILLGELLHMANTILPHSHSHHLHCLPTLMNMAASFDIPQ 468

  Fly   460 GNQ-QANAAVAALQNYQKLLRQRPASRSLFLDSIIQGGALIQTRLFRRHLNVQEQAGPVLQLQET 523
            |.: :|:|||..|:.:.:..::.|...||:||.|:: .:|.......:||..|..   :..:::|
Zfish   469 GKRLRASAAVNYLKRFHEKKKRGPKPNSLYLDLIVR-KSLAAHYCRDQHLRPQRD---IFVIKDT 529

  Fly   524 AEAAAFAVPPVTQFRGTLDRSRLDSVSSSDESNSQASTSSRSSFRLKRKFLPQALYDNFRAFNRL 588
            .|                                                   ||..|.|     
Zfish   530 EE---------------------------------------------------ALMMNLR----- 538

  Fly   589 LTDSRVLSQADAHLWDWDVITTILK---SNLIRKLDYTQGKFLKRLVDFYKPRNNRFSHQDL-VP 649
              ||::|:......|:|.:|:||||   .||....:....||::||:.||||.:..::..:| ..
Zfish   539 --DSQILNHKQNLEWNWVLISTILKWPNVNLRNNKEEQMHKFVRRLLFFYKPSSKLYASLELDYS 601

  Fly   650 GQRLPTYVSAGLDLIDVLLSSNELECMRFITDYFSDISQQLAAVTTSNRAHDCLFSPQHMNNTMC 714
            ..|..|.|  |...|:.||.|:| :...::.|...||.|.|:|  :|....|.......:..|:.
Zfish   602 KARQLTVV--GCQFIEFLLESDE-DGQGYLEDLVKDIVQWLSA--SSGLKPDRSLQSNGLLTTLS 661

  Fly   715 QQYFLYIGRMCRTVKGIEVLKNTTVFEYLINL--VRVTDHVCYVKLIVSGLNYSYEKLPRQVLEK 777
            |.|||::|.:....:|:::|:..:||:.|:||  ::..||:  :||:||.|:||.:.|.|.:|.|
Zfish   662 QHYFLFLGTLSANPQGVKMLEKCSVFQCLLNLCSLKNQDHL--LKLVVSTLDYSRDGLARVILSK 724

  Fly   778 ALTSAKTRGRLYSTQFMAVLLRARLPHFEVWGIPLIINQTRDSDRSVGLAAMDVLEEACHDKYYL 842
            .||:|....|||:|:.:.|||||.:..|..|||.|::.|..|..::|.:.|:|:|:|||.||..|
Zfish   725 ILTAATDNCRLYATKHLRVLLRANVEFFSNWGIELLVTQLHDRSKAVSVEALDILDEACEDKANL 789

  Fly   843 EEIVSRWPNLTHRGDAGRLLMARYYSLPRGLNSTMAR--IEDEIRYWRNGYNKRYVLLVEADTHS 905
            ..::...|.|||.||.|.||:.|:.|:|:|.:....|  :..::..|:..||.:||.|:|...:.
Zfish   790 HALIHMKPALTHLGDKGVLLLLRFLSIPKGFSYLNERGYVSKQLEKWQKEYNLKYVDLIEEQLNE 854

  Fly   906 SLTLHIRNEDGYYSRRNCNQRPQTVPPNV--APHLYGQMAQTGQGMTALRKHGDLPQLLELLRRA 968
            :||.:.:..||....|..|||.|.  |||  ..|||||:.....|...|.....:..|...: |.
Zfish   855 ALTTYRKPVDGDNYVRRSNQRLQR--PNVFLPVHLYGQLVHDKTGCHLLEAQNVVSDLSYTV-RC 916

  Fly   969 KCTDDAECL-ELKAAIWALAHASTHSNGIEYFVELNARLYEKLIVLVTKCEVYSVRATCFSALGL 1032
            ...|..|.: :||||:|||.:..|.:.|:....|.|  :...::.|...|||.|:|.||...|||
Zfish   917 PLLDKWEGIKQLKAALWALGNIGTSNWGLNLLQEEN--VIPDIVALAHDCEVLSIRGTCLYVLGL 979

  Fly  1033 IAGTQAGANILFKLNWLSVRHDKNTMWPV-----------------HQ---------PEDW-MSS 1070
            |:.|:.|..:|....|.:|||::..:|||                 ||         |... ::|
Zfish   980 ISKTKQGCEVLKLHGWDAVRHNRRQLWPVVPDEVEQHQNLQQQQQQHQQPLIHLSSAPSTLSLTS 1044

  Fly  1071 QYTPVRHYYE-DVPADNMTMMDD---------------YIERFYETGSDFWHM------------ 1107
            :.|..||..| |.....|.::||               :..:..:..|.|..:            
Zfish  1045 ESTSSRHNSESDSIQPTMYILDDEKLESSELSEDQPLYFRPKLLKDRSPFTILASSRLVRNRFLI 1109

  Fly  1108 ------LADQTDASGGG-----------GGV---------------AGTVVGMHPIVQD------ 1134
                  |...:|..|.|           ||:               .|.|  ..|:..|      
Zfish  1110 SLSGKKLRSTSDPKGTGSSSKLQGELTLGGLRRVRTVTEPSIFSSSQGDV--FSPVFTDGHLPKS 1172

  Fly  1135 PNA----------TITTTDSV-----------RTT-----TDDVHPRMLVGVAAKSKTLPEGSNL 1173
            |:.          |:.|.||.           ||.     ..|.|...    .::.:...:||..
Zfish  1173 PSVSLETSFVGTKTLDTQDSTSSIGEQEVRLNRTAERSSGVGDTHREQ----TSRERLAGDGSTS 1233

  Fly  1174 RQGKHQRSLSESKTTDVISLLGSGVGTMSGAVLYPTPYQHRIRYNSCTDSNTSGVSSCESV---- 1234
            ..|...:|.|:|..||..:   ||:.:||.     :|.:..:   .|.||:|.. :.|.|:    
Zfish  1234 GSGAQFKSRSQSFNTDTTT---SGISSMSS-----SPSRETV---GCVDSSTID-TDCVSLNTVI 1286

  Fly  1235 ---TGRTAAAYAAAANELQQFPLSPIPSMSNLL----ESDELFRRNQLATSMLPSTL-------- 1284
               |.:|..:....:|.|   .||  .|.|.||    .|..|.||.|...|...:|:        
Zfish  1287 STQTVKTLHSLTPQSNHL---TLS--KSNSVLLMPPGSSHTLPRRAQSLKSPSVTTISSLTDCSF 1346

  Fly  1285 ---SPMAMKGYVQLRSLRKHS-RPVFSESSAEFYDFAEILDTPEVQMR--KLDWTHSHRRL---K 1340
               ||....||..|:.|::.. .|..|.|.|......::|.|..:.|:  .||...:.||.   :
Zfish  1347 MYTSPRDALGYATLKRLQQQRIHPSLSHSEALASPAKDVLFTDAITMKTGSLDSRLTPRRCTKKR 1411

  Fly  1341 VRSLDRQLSDVYRRLSADELNVLLPT-LNAPKF--LPPNDLKGPC-------------------- 1382
            .|.|.:..|..:||       .|||. |.|..|  |...||..|.                    
Zfish  1412 FRCLGQGSSRPHRR-------SLLPRFLKALSFASLDKEDLLSPISQTSLQRSSSVRSMVSSVTY 1469

  Fly  1383 -----YAGICLPKNVLDLF--------------PTRNLSRTYVSRDIQDQDIVGINLLNTMLRPQ 1428
                 |.|:.||.::..:|              |:.:.:..:.|.:......|.   .:::||.|
Zfish  1470 GSSDDYIGLALPMDINSMFQIKDTPYFQKRKSPPSEDRAAKFFSGEADGSSEVS---RHSVLRSQ 1531

  Fly  1429 CLNDSLTNEGGDESSVISSLSDVSSASRRQTRQLQQGA------KHSRSLCLHCA---------R 1478
            .                 |::::.:.||.:..|: .||      :|:...||:||         .
Zfish  1532 L-----------------SITELIAVSRMEKHQM-LGAEETGLQEHTEENCLYCAGLYVLGCNSS 1578

  Fly  1479 SPRQQRNDSGSHSNGGGGASLAPCELYSSAA-AALVAAGIQAGPVLAKKSGSSAQGASAAL--GA 1540
            |..|.|.|                  |..|. :......|....|:.:...|...|.|.|:  |:
Zfish  1579 SATQSRTD------------------YPDATFSEWCNQSIHNLEVMPQSKYSGVSGCSDAVSQGS 1625

  Fly  1541 DISFHSPESMLSEDSLPD-------RLTASILYNVQRLANPVSAKQSKMALLELKQKHPHAFQDI 1598
            ..|..|.|.:|...::|:       .|...:|..|..|::.|..|.::..||.:|:|.|:||.||
Zfish  1626 GGSTRSTELVLGVKNIPEDAPACRVLLRKEVLRLVINLSSSVGTKGNETGLLTIKEKFPYAFDDI 1690

  Fly  1599 CLYSEACKTIGRSSYRMIARRFLQELFLDLNFDSFYVEPQLIIGARK 1645
            |||||....:....:|:.:|||:||||.|:.|...|.|.:.|:...|
Zfish  1691 CLYSEVSYLLAHCMFRLASRRFIQELFQDVQFIPMYEEAESILSMPK 1737

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rictorNP_573371.1 RICTOR_N 63..440 CDD:291336 146/382 (38%)
RICTOR_M 583..798 CDD:291338 74/221 (33%)
RasGEF_N_2 805..908 CDD:291335 39/105 (37%)
RICTOR_V 977..1047 CDD:291340 26/71 (37%)
rictorbXP_009293661.1 RICTOR_N 65..442 CDD:291336 146/381 (38%)
RICTOR_M 530..745 CDD:291338 78/280 (28%)
RasGEF_N_2 752..858 CDD:291335 40/106 (38%)
RICTOR_V 927..994 CDD:291340 26/69 (38%)
RICTOR_phospho 1093..1206 CDD:291337 17/115 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C343927277
eggNOG 1 0.900 E1_KOG3694
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 641 1.000 Inparanoid score I774
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D128601at2759
OrthoFinder 1 1.000 FOG0003100
OrthoInspector 1 1.000 T597855
orthoMCL 1 0.900 OOG5_130440
Panther 1 1.100 LDO PTHR13298
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1404
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.